KEGG   Larimichthys crocea (large yellow croaker): 104940547
Entry
104940547         CDS       T04659                                 

Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C isoform X1
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco04010  MAPK signaling pathway
lco04020  Calcium signaling pathway
lco04260  Cardiac muscle contraction
lco04261  Adrenergic signaling in cardiomyocytes
lco04270  Vascular smooth muscle contraction
lco04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:lco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104940547
   04020 Calcium signaling pathway
    104940547
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    104940547
  09153 Circulatory system
   04260 Cardiac muscle contraction
    104940547
   04261 Adrenergic signaling in cardiomyocytes
    104940547
   04270 Vascular smooth muscle contraction
    104940547
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lco04040]
    104940547
Ion channels [BR:lco04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   104940547
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel
Other DBs
NCBI-GeneID: 104940547
NCBI-ProteinID: XP_027128176
LinkDB
Position
XX
AA seq 2193 aa
MMGNAASSGGAGLGSGGGGPISTASSTQRKRQHYSSKPKKQTTTTATRPPRALLCLTLKN
PIRRACISIVEWKPFEIIILMTIFANCVALAVYIPFPEDDSNATNSNLERVEYLFLIIFT
VEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKVDGATPIGGKAAGF
DVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFM
GKMHKTCYYKHSANAEEKPAPCAPDGAYGRHCMRNGTECKVGWEGPNDGITNFDNFAFAM
LTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKERE
KAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEEEGMDDDKPRNLSMPASENES
VNTDNVPGGDVEGETCCTRLANRISKSKFSRYSRRWNRLCRRKCRAAVKSQVFYWLVIFL
VFLNTLTIASEHHRQPQWLTDVQDIANKVLLALFTGEMLLKMYSLGLQAYFVSLFNRFDS
FVVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIAS
LLLLLFLFIIIFSLLGMQLFGGKFNFDETRRSTFDNFPQSLLTVFQILTGEDWNSVMYDG
IMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKER
KKLARLASPEKRHNNEKPPLEEEKKEKIELKSITSDGETNTATKINIDEYCGDESEEKNP
YPANDYIGDDDDDEPEMPVGPRPRPLSDIQLKEKAIPMPEARAFFIFSHTNKFRVLCHKI
VNHNIFTNLILFFILLSSISLAAEDPVKNESFRNQILGYADHVFTGLFTIEIILKMTAYG
AFLHKGSFCRNYFNILDLVVVSVSLISSGIQSSAINVVKILRVLRVLRPLRAINRAKGLK
HVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKFFVCSDNSKQTQAECRGSYIMY
KDGDVGKPERAQRVWENSDFNFDNVLQGMMALFAVSTFEGWPGLLYRAIDSHAEDVGPIY
NYRVVISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKA
RPLRRYIPKNPYQYKVWYVVNSTYFEYLMFTLILLNTICLAMQHHGQTKNFNDAMNILNM
LFTGLFTVEMILKLIAFKPRGYFSDPWNVFDFLIVIGSIIDVILSEINPADSSSSSSSSS
SSSSSSSSSSHPPAVRPMGLQNSEENARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFI
KSFQALPYVALLIVMLFFIYAVIGMQMFGKIALRDHTEINRNNNFQTFPQAVLLLFRCAT
GEAWQEIMLACYINKPCEKGSTNENNTHNEDCGSQFAIIYFVSFYMLCAFLIINLFVAVI
MDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCP
HRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIVKKIWKR
TSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVAKVPPKTALSLQAGL
RTLHDIGPEIRRAISGDLTVEEELDKGLKEPVSAASEDDIFRVKRTGGLFSNHVNYYNQS
DGRSSFPQSFTTQRPLHISQKGSPCEGESPSHEKLMDSTTFTPSSYSSSGSNANINNANN
TGMAGVTTQGISRFPSPSISTVDGHTGQPLTPILLPRSAWCFPPKRTYFYDTLMRSDSSD
SHLPIIRRGEGSTEETYDESYVDDREYHEDDHSLSSDMLVYQDDTCKQLTPMEEGEEVED
RRGGGWQSPRRVFLCPTSLGRRSSFHLECLRRQSRPDVSQKTAVPLHLVHHQALAVAGLS
PLLRRSHSPTLFSRLCSTPPASPTAHGSDASYQRVPSLRLEGSNSHEKLNTSLPSVNCGP
WYSDSNGNSRVPSPSTSVSVPTQRPRPVSLTVPSLLGKDSSSLSHGSAGSLVEAVLISEG
LGHFAQDPSFIEVTKAELADACDMTIEEMEHAANNILNGNTATNATSSTSSTSQHSPNGN
LLPFHTAAAATHRDQAVNEGGEEAGGSRGSVHEPSSVEERQELLAGGRGPEEEEEEVEVK
EEGHHRSSVVIGAARQRNSGLLEDEDMECVTSL
NT seq 6582 nt   +upstreamnt  +downstreamnt
atgatgggcaatgctgcatcaagcggaggggcggggcttgggtcgggagggggcgggccc
atctccacggccagctctacgcaaaggaagagacaacactatagctctaagcccaagaaa
cagacaacaacgacagccacaaggccaccacgggccctgctctgtctcacgctcaagaac
cccatccgcagggcctgtatcagcatcgtagagtggaaaccatttgagatcatcatcctg
atgaccatttttgccaactgtgtggccttagctgtctacatccccttccctgaggatgat
tcgaacgccaccaactccaacctggagcgcgtggagtatctgttcctcatcattttcaca
gtggaggcattcctgaaggtaatagcctatggcctgctcttccaccccaacgcctacctg
aggaatggctggaatctgctggacttcatcatcgtagtcgtagggttattcagtgcgatc
ttggagcaggccaccaaggtggacggtgccactcctattggagggaaggcagcgggcttt
gatgtcaaggctctgagggcattcagagtactcagacccctcagactggtctctggagta
cccagtttacaggtagtgttgaactccataatcaaagccatggttcccctgctccacatt
gccctgctggtcctctttgtcatcatcatctatgccatcatcggcctggaactcttcatg
ggcaagatgcacaagacctgctattacaagcattcagccaatgcagaggaaaagccggca
ccgtgtgcaccggacggagcttatggtcgacactgtatgcgtaacggaacagagtgtaaa
gtgggatgggagggcccaaacgacggcatcacaaactttgacaactttgcctttgccatg
ttgacggtgttccagtgtataaccatggagggctggacagacgtgctgtactggatgcag
gatgctatgggctatgagctgccatgggtctattttgtctctctcgtcatcttcggctcc
tttttcgttctcaatctcgttctgggggtgttgagcggagagttttccaaggagcgagag
aaggccaaggcacgtggtgacttccagaaactcagagaaaaacagcaactggaagaggac
ctcaagggctatttagactggatcactcaggctgaagacattgaccccgagaatgaagag
gagggcatggacgatgacaaacccagaaacctgagcatgccagccagcgagaatgaatca
gtcaacacagacaatgttcccgggggagacgtggagggggagacctgttgtacccggcta
gcaaataggatctccaaatcgaagttcagtcgatactctcggaggtggaacaggctgtgt
aggaggaagtgccgggcagcagtcaaatcacaggttttctattggctggtcatcttcctg
gttttcctcaacactctgacaatcgcctctgagcatcaccggcagcctcagtggttaact
gatgtacaagacatagctaacaaagtgttactagctctcttcactggtgagatgctgttg
aagatgtacagcctgggtctacaggcgtactttgtttcactcttcaatcgctttgacagc
ttcgtagtatgcggaggaattcttgagaccattctggtggaaactaagatcatgtctcct
ctcggcatctctgtgttacgttgtgtacgcctgctgagaattttcaaaataaccagatac
tggaactccctgtccaacctggtggcctccctgctaaactctgttcgctccatcgcttcc
ctgctgctcctgctcttcctcttcatcatcatcttctccctgcttggcatgcagctcttt
ggggggaaattcaacttcgacgaaacccgacgcagcacctttgacaactttccccagtct
ctgctcactgtgtttcagatcctaacaggagaggactggaactctgtgatgtatgatggc
atcatggcgtatggtggaccatccttccccggcatgctggtctgcatctacttcatcatc
ctcttcatctgtggaaactatatcctactgaatgtcttcttggccatcgctgtggacaat
ttggcagacgctgagagcctcacatccgcccagaaagaagaggaagaggagaaggagagg
aaaaaactagccaggttggccagcccagagaagcgccataacaatgagaagccgcctctg
gaggaggagaagaaggagaagatagagctgaagtccatcacctctgatggagagactaac
actgctactaagattaacatagatgagtactgtggagatgagagtgaagagaagaatcca
tatcctgccaatgattacataggagacgatgatgacgatgagccagagatgccagtgggc
ccaaggccacggccactgtccgacattcagctgaaggagaaggccattcctatgcctgag
gcccgcgctttcttcatcttcagccacaccaacaaattcagggttctgtgccataagatc
gtcaaccacaacatcttcaccaacctcatcctcttcttcatcctgctcagcagcatcagt
ctggcagcagaggacccagtcaaaaatgaatctttcagaaaccagatcctgggctatgca
gaccatgtctttactggactcttcaccatagagatcattctaaagatgacagcctatgga
gccttcctccataaaggttcattttgtagaaactatttcaatattctggacctggtggtg
gtcagtgtgtctctcatctcctctggaatacaatctagtgcaattaatgtggtgaagatc
ctgagagttctgcgagtgctcagaccgttaagggccatcaacagagccaagggactaaag
catgtagtacagtgcgtgtttgtggccatcaggaccatcggcaacattgtcattgtcacc
acgttgctgcagttcatgtttgcctgtattggagtacaactctttaagggcaagttcttc
gtctgttccgacaactctaaacaaacccaggcagagtgcaggggttcctacattatgtat
aaggacggtgatgtgggaaaacctgaaagagcccagagagtgtgggagaacagtgacttt
aactttgataatgtcctgcaaggcatgatggctctgttcgctgtgtctacgtttgagggc
tggccagggttattgtaccgagccatagactctcacgctgaagatgttgggcccatctac
aactaccgtgtagtcatctccatcttcttcatcatctacatcatcatcatcgccttcttc
atgatgaacatcttcgtcggtttcgtcatcgttacattccaggagcaaggagagcaagaa
tataagaactgtgagctggacaagaaccagcgccagtgcgtagagtatgctttgaaggca
cgtccattgcgtcgctacatccccaagaacccttatcagtacaaggtgtggtatgtggtc
aactccacctactttgagtacctgatgttcacactcatccttctcaacaccatctgtctg
gccatgcagcatcatggacagaccaaaaatttcaatgatgccatgaacatcctcaacatg
ctcttcactggactcttcactgtggagatgatccttaaactgatcgccttcaaacccagg
gggtactttagtgatccctggaatgtgtttgatttcctcatcgtaattggcagcataata
gacgtcattctcagtgagatcaacccagctgactcctcctcgtcctcgtcctcctcctct
tcgtcctcctcctcctcctcttcctcctctcacccccctgcggtaaggccaatgggactg
cagaactctgaagagaacgccaggatctccatcaccttcttccggctgttccgcgtgatg
aggctggtgaagctgctgtctcgcggggaagggattcggaccctgctgtggaccttcatc
aaatccttccaagcactgccctacgtagctctacttatagtgatgctattcttcatatac
gctgtcatcggtatgcagatgtttggtaaaatagcgctgcgggaccatacagagatcaac
aggaacaacaatttccagacgttccctcaggcagtgctgctgctcttcagatgtgcaaca
ggtgaggcatggcaggagatcatgctggcgtgctatatcaataagccgtgtgagaaagga
tcaaccaatgagaacaatacgcacaacgaggactgtggcagccagtttgccatcatttac
tttgtcagcttctacatgctctgcgcctttctgatcatcaacctgtttgtggccgtcatc
atggacaactttgactacctgacacgtgattggtcaatcctggggccacatcatcttgat
gaattcaagaggatctgggctgaatatgatccggaggctaaggggaggataaagcatctg
gatgttgtgactctgctgcggagaatccagcctcccctcggttttggaaaactctgtcca
cacagggtggcctgcaagcgtctggtgtcgatgaacatgcctctgaacagtgatggaaca
gtgatgttcaacgccacactgtttgccttggtcagaaccgcactcaggatcaagacagaa
ggtaacttggagcaggccaatgaggaactgagggcaatagtgaagaagatctggaagaga
actagcatgaagctcttggatcaagtagtgccccctgctggtgatgatgaggtaacagtt
gggaagttctacgctaccttcctcatccaggaatatttccgcaagtttaagaagaggaaa
gaacaaggcctcgtggccaaggtgccccccaaaactgccctctctctgcaggcgggcctg
cggacattgcatgacattggtccagagattcggagggccatctctggagatctgactgtg
gaggaggagctggataaaggcttgaaggagcctgtgtcagctgcatccgaggacgatatc
ttcagggtaaagcgtacaggcgggttgttcagcaaccacgtcaactactacaaccagagc
gatggccgcagttcttttccacagtccttcactacgcagcgtcccttgcacatcagccaa
aagggctccccttgtgaaggcgagagcccatctcatgagaagctcatggactcaaccact
ttcaccccttcctcttactcttcatcaggctccaacgccaacattaacaatgccaacaac
accggcatggccggggtgacaacccagggaatcagtcgattcccaagcccgtccattagc
actgtggacgggcacacaggacagccgctcacccccatcctgttgccaagatcagcgtgg
tgctttcctccaaagaggacgtatttttatgacaccctcatgcgctcggattcaagtgac
agccatctgccaatcatccgaagaggcgaggggtcaacagaggagacgtatgatgagagc
tacgtcgacgacagggagtaccatgaggacgaccattcgctctcctctgacatgcttgtg
taccaagatgacacatgtaagcagttgactcccatggaggaaggagaggaggtagaagac
agaagaggaggaggatggcagtctcccaggagagtcttcctctgccccacttctctggga
cggagatcctccttccatctggagtgtctcaggagacagtcaagaccagacgtctcccag
aagacggctgtacccctacaccttgtacatcatcaggctctggcagtggcagggttgagt
cctctgctaagaagaagtcactcacctacactcttcagccggctgtgctctacgcctcca
gccagtcccacagcccatggcagtgatgcctcctaccagcgagtaccctctctgaggcta
gagggctccaactcccatgaaaagctcaataccagtttgccctctgtcaactgcgggccc
tggtacagtgacagtaatgggaacagccgggtgcccagtccaagcaccagtgtgtcagtg
cccactcaaagaccgcggccggtgtcactcacagtgccctcactactgggaaaagactcc
agctcactgtctcatggcagcgcaggcagtctggtggaggcggtgctaatatcagagggt
ttgggtcattttgcccaggacccgtcgttcattgaggtgaccaaagccgagttggccgat
gcctgcgacatgaccattgaggagatggagcacgccgccaacaacattctcaacggcaac
accgccacgaacgccacatccagcacctcctccacctcccagcacagccccaatggcaac
ctcctccctttccacacagcagcagcagcaacgcacagggaccaagcggtcaacgagggc
ggggaagaggccggaggaagcagaggctccgtccatgagccatcctcagtggaggagcgg
caggagctgctagcaggggggaggggaccagaagaggaggaggaagaagtggaagtgaag
gaggaggggcaccacagaagctcggttgtaattggggcagcacggcagaggaacagcggg
ctgttggaggacgaggatatggagtgtgtgacaagtttgtag

DBGET integrated database retrieval system