KEGG   Lysinibacillus varians: T479_14740Help
Entry
T479_14740        CDS       T03062                                 

Definition
(GenBank) anthranilate synthase subunit II
  KO
K01658  anthranilate synthase component II [EC:4.1.3.27]
Organism
lgy  Lysinibacillus varians
Pathway
lgy00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lgy01100  Metabolic pathways
lgy01110  Biosynthesis of secondary metabolites
lgy01130  Biosynthesis of antibiotics
lgy01230  Biosynthesis of amino acids
lgy02024  Quorum sensing
Module
lgy_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lgy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    T479_14740
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    T479_14740
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    T479_14740
Enzymes [BR:lgy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     T479_14740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase Peptidase_C26 Peripla_BP_2 NBD94
Motif
Other DBs
NCBI-ProteinID: AHN22438
UniProt: X2GQ50
LinkDB All DBs
Position
complement(2939344..2939913)
Genome map
AA seq 189 aa AA seqDB search
MILLIDNYDSFTYNLFQQVSMLGKEVQVVRNDEVTIEEIIDMQPEAIILSPGPGTPNEAG
ITVQVVQELYTKYPILGICLGHQSIGQAFGGTIEQAKNIMHGKLSALQYEQTGVFAQFEG
DMEVMRYHSLIIEPSTLHEDFIITATSRDDGEIMAIQHKHYPLVGLQFHPESIGTKTGSD
IVQAFLALV
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgattttactcatcgataattatgattcattcacatataatttatttcagcaagtcagt
atgcttggtaaggaagttcaagtagtaaggaatgatgaagtaacaattgaagaaataatt
gacatgcaaccagaagcaattattttatcaccaggtccaggtacaccaaatgaggcagga
atcacagtacaagttgtacaagaactatatacaaaatatccgattttagggatttgttta
ggtcatcagtcgatagggcaggcatttgggggaacaattgagcaagctaaaaatataatg
catggcaagctatctgctctacagtatgagcaaacaggcgtttttgcgcaattcgaaggt
gatatggaagtgatgcgctatcactcgttaatcatagagccatccacgttgcatgaagat
tttattataactgccacttcgcgtgatgatggagaaattatggctattcaacataagcac
tatccacttgttggattgcaattccatccagaatcaataggcactaagacaggtagtgac
atcgtgcaagcctttttagcactcgtttag

DBGET integrated database retrieval system