KEGG   Lactobacillus johnsonii NCC 533: LJ_0565
Entry
LJ_0565           CDS       T00158                                 

Definition
(GenBank) UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--lysine ligase
  KO
K01928  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
ljo00300  Lysine biosynthesis
ljo00550  Peptidoglycan biosynthesis
ljo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ljo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    LJ_0565
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LJ_0565
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ljo01011]
    LJ_0565
Enzymes [BR:ljo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     LJ_0565
Peptidoglycan biosynthesis and degradation proteins [BR:ljo01011]
 Precursor biosynthesis
  Amino acid ligase
   LJ_0565
SSDB
Motif
Pfam: Mur_ligase_M Mur_ligase_C
Other DBs
NCBI-ProteinID: AAS09656
UniProt: Q74HN4
LinkDB
Position
complement(1815610..1817181)
AA seq 523 aa
MSDSSISLNTCILILKEHHLLKSSAVQDAVPTKMDYISYDSRDIKTNTLFFCKGKGFRPT
YLSMAKDSGATCYVAEQPYPEGKGMHALVVRDVTKAMALLSAAFYRFPQDDLYVVAFTGT
KGKTTSAYFLKGMLDQINGGRTALFSSVDDIVGPKPEDKFKASLTTPESLDLFRDMRTAV
DNGMTHLVMEVSSQAYKKNRVFGLTYDLGFFLNITPDHIGPNEHPNFADYLHCKLQLMVN
SRKCIINAMSDHFDEIYAAATTTTNPDSIYLFARNDFENPNLKQPIDFRFQSVETDMKET
EFKLFCASDKAKKLPIAGDYTLQMIGDFNEMNGTAAIIGAGLAGENYEECAKGIRHVTIP
GRMEALPSKNHGTVIVDYAHNKASMMALMSFMQREFNNPKIIVVVGAPGDKGVSRRPGFS
ESLTAYADKAFLTTDDPGFEDPMDIAQEIDAGIDHEKVDVTIELDREKAIHDAIAMSDKD
DIVLICGKGADPYQKIRGVDTPYPTDIKVAESVINELEKDDEE
NT seq 1572 nt   +upstreamnt  +downstreamnt
atgagcgattctagcatttctttaaacacttgcatcttaatattgaaggaacaccacttg
cttaaatcaagcgctgttcaagatgcggttccaactaaaatggattatatttcctatgat
tcacgtgatataaaaacaaatactttgtttttctgtaaaggtaaaggctttagacctact
tatttatcaatggctaaagatagtggagctacttgttatgtagcagaacaaccatatcca
gaaggtaaaggaatgcatgctttagttgttagagatgtaactaaagccatggctctttta
tctgctgccttttacagattcccgcaagatgatttatatgtagtagcctttaccggtaca
aagggtaagacaacatctgcatatttcttgaaggggatgcttgaccaaattaatggtggt
cgaacagcactattttcatcagtagatgatattgtaggaccaaagcctgaagacaaattt
aaggcgagtttaactacacccgaaagtttagacttgttcagagatatgagaacagctgtt
gataacggtatgactcatttagtaatggaagtttctagtcaggcttataagaaaaatcgt
gtctttggtttaacttacgatctcggatttttcttaaatattactccagatcacattgga
ccaaatgaacaccctaactttgcagattatttgcactgtaagttgcaattaatggttaac
tcacgtaagtgtattatcaatgcaatgtctgatcactttgatgagatttatgcagctgca
actactactacgaatccagatagtatctatttatttgccagaaatgattttgaaaatcct
aacttaaagcaaccaattgatttccgtttccaatcagttgaaactgatatgaaagaaact
gaattcaaattattctgtgcatctgataaagctaagaaattaccaattgctggtgactac
actcttcaaatgattggtgatttcaacgaaatgaatggtactgctgctattattggtgct
ggacttgccggcgaaaattatgaagaatgtgctaaaggtattcgtcacgttactattcca
ggaagaatggaagctttgccatcaaagaatcatggtactgtaattgttgattatgcacat
aataaggcttcaatgatggctttaatgagctttatgcagcgtgaatttaacaatccaaaa
atcatcgtagttgttggagctcctggtgataaaggagtatcacgtcgaccaggatttagt
gagagtttaactgcttatgcagataaagcctttttaacaactgatgatcctggttttgaa
gatccaatggatatcgcacaggaaattgatgcaggcattgatcatgaaaaagttgatgtc
acaattgagttagatcgtgaaaaggcaattcatgatgcaattgcaatgtccgataaggat
gacatcgttttgatttgtggtaagggagccgacccataccaaaagattcgcggagtagat
acaccatatccaactgacatcaaagttgcggaaagtgtaattaatgaactagaaaaagat
gatgaggaatag

DBGET integrated database retrieval system