KEGG   Lactobacillus mucosae: LBLM1_07285
Entry
LBLM1_07285       CDS       T03814                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA synthase
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
lmu  Lactobacillus mucosae
Pathway
lmu00072  Synthesis and degradation of ketone bodies
lmu00280  Valine, leucine and isoleucine degradation
lmu00650  Butanoate metabolism
lmu00900  Terpenoid backbone biosynthesis
lmu01100  Metabolic pathways
lmu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    LBLM1_07285
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    LBLM1_07285
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LBLM1_07285
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LBLM1_07285
Enzymes [BR:lmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     LBLM1_07285
SSDB
Motif
Pfam: HMG_CoA_synt_C HMG_CoA_synt_N ACP_syn_III Chal_sti_synt_N ACP_syn_III_C
Other DBs
NCBI-ProteinID: AJT50823
UniProt: A0A0D4CL32
LinkDB
Position
complement(1587956..1589122)
AA seq 388 aa
MKIGIDKMAFATTSEYIDLAELAKVRGVDPNKYLIGIGQSEQAVLPPTQDIVTLGVAAAD
KMLNERDRERIATVIVATESGIDNSKASAIYVKRLLNLDDYVRTVEVKEACYSATAAIQF
ARGQVALEPEKAVLVIAADVARYGLKTAGEVTQGAGAVAMLITAAPRILAIERTSVAYSQ
DVMDFWRPLYATEAMVDGKYSTNVYIDFFKHTLSRYEKLTDRKLDDFAAIAFHLPFTKMG
KKALEAVLGERDDQTAWRLRKALLASQNYSRRVGNLYTGSLYLSLMSLLQNDPDLKQGER
IGLFSYGSGAEGEFYSGILQPGYQEQLSNVAGDLSERQLISIAAYEQQFNDQLGMNKADV
EYDISADPARFVLAGQKNHQRQYVDKQR
NT seq 1167 nt   +upstreamnt  +downstreamnt
atgaagatcggaattgataagatggcgtttgcgacaacgtcagaatatattgacctggca
gaattagcaaaagtgcgcggtgtcgatcccaataaatatctaattggcattggtcaaagc
gagcaggcagttttaccgcctacgcaggatatcgtgacactgggagttgctgctgccgac
aaaatgctgaatgaacgtgatcgagagcgcattgccacggtgatcgttgctaccgaatca
ggaatcgacaactccaaagccagcgcaatctatgttaagcggctgctgaatctggatgac
tatgtacggaccgttgaagttaaggaagcctgttattcagcaacggctgcgattcagttt
gccagaggacaggtggcacttgagccagaaaaggcggttttggtaattgcagctgacgtg
gcgcgttatggcttaaagacggctggcgaggttacgcagggagcaggggccgttgccatg
ctgattacggctgcaccgaggatcctggcaattgaacggaccagcgttgcttattcgcaa
gacgtgatggacttttggcggccgctttatgctactgaagccatggtcgatggcaagtat
tcgaccaacgtctacattgactttttcaagcatacgctgagtcgctatgaaaaattaacg
gatcgcaagctggatgattttgcggcaatcgcttttcatctgccattcactaaaatgggc
aaaaaagctttggaagctgtcttgggtgaacgggatgatcaaacggcctggcgtctgcgc
aaggcactgctggccagccaaaactacagccgccgggtcggcaatctctataccggttcg
ctttatttaagcttgatgtcgcttttgcaaaatgaccctgatctaaagcaaggtgagcgc
atcggcctgtttagctatggatccggtgcggaaggcgagttttacagcgggattctgcag
cctggctatcaagaacagctgagcaacgtggctggagatctcagtgaacgccagctgatt
tcgattgcggcctatgagcagcagttcaatgaccagttaggaatgaataaagcagatgtt
gagtacgacatcagtgcggatccggctcgtttcgtcttagccggtcaaaagaatcatcag
cgccaatacgttgacaagcaacgatag

DBGET integrated database retrieval system