KEGG   Lutibacter sp. LPB0138: LPB138_12290Help
Entry
LPB138_12290      CDS       T04497                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
lul  Lutibacter sp. LPB0138
Pathway
lul00020  Citrate cycle (TCA cycle)
lul00310  Lysine degradation
lul00380  Tryptophan metabolism
lul01100  Metabolic pathways
lul01110  Biosynthesis of secondary metabolites
lul01120  Microbial metabolism in diverse environments
lul01130  Biosynthesis of antibiotics
lul01200  Carbon metabolism
Module
lul_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lul_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lul00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LPB138_12290
  Amino acid metabolism
   00310 Lysine degradation
    LPB138_12290
   00380 Tryptophan metabolism
    LPB138_12290
Enzymes [BR:lul01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     LPB138_12290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AOW21410
UniProt: A0A1D8P9Z4
LinkDB All DBs
Position
complement(2759119..2761857)
Genome map
AA seq 912 aa AA seqDB search
MDKFSFLNATHTSFIADLYDQYLVNPDSVEPSWRSFFQGYDLANENYSIDGEEVSVEIPE
HLNKEFQVLDLINGYKTRGHLFTKTNPVRNRRTYEPTLDIENFGLSKDDLETQFDAGEVI
GLGNTSLKNIIYKLEEVYCDSIGVEYMYIRKPEIIKWWQDKLNENNNHPKYSVESKKYIL
SKLNQAVTFENFLQTKYVGQKRFSLEGGESLIPAISVVLFNAVLDYDVKECVLGMAHRGR
LSTLVNIFRKPFNELFSEFEGKDFEDEDIDGDVKYHLGLTLDKTYQNGKTLKMNLVPNPS
HLETVAPVAEGITRAKIDKDYNGDDSKILPIIVHGDAAIAGQGIAYEVIQMSQLNGYKTG
GTIHIVVNNQIGFTTNYLDARSSTYCTDVGKVTLSPVLHVNADDAEAVVHAVELAVDYRM
KFKRDIFIDLLGYRKYGHNEGDEPRFTQPKLYKAISKHSNPLKIYTDKLIAEGTIDEAYS
KKIVADFKEKLEEEYTISKESDSSKVREFMEERWTDFNRQKLDGMLKSVDSTYPSENLKN
IAKVVSTVPKGVKFVRKAERILAGRADMVFKTDTLDWGMAETLAYGSLLEEGFDVRISGQ
DVERGTFSHRHAILRDEISEERINLLNTNPFNKGEMYIYNSLLSEYGVLGFDYGYAMANP
NTLTIWEAQFGDFSNGAQIIFDQYLSAAEDKWKMQNGIVVLLPHGYESQGSEHSSARMER
YLQMCGVDNMIVADCTTPANFFHLLRRQMKRDFRKPLIVLTPKSLLRHPKAVSSIGELEN
GQFQEVIDDTINPDKVKKLVFCTGKFYYDLLTERESLKRDDVALVRIEQLFPLHEEKIQK
VIDRYKNVEKYVWAQEEPKNMGAWSYMLQRFELVKLEVASRPYASVPAPGSSTRDKKRQR
QVIDSVFDTTSK
NT seq 2739 nt NT seq  +upstreamnt  +downstreamnt
atggataaattttcgtttttaaatgcaactcatacaagctttattgctgatttgtatgat
caatatttagtcaatccagatagtgtagaacctagttggagaagtttttttcaaggttac
gatttagctaatgaaaactacagtattgatggagaagaggtttcagttgaaatacctgaa
cacctaaataaagaatttcaagttctagatttaataaatggctacaaaacaagaggtcat
ttattcactaaaaccaatcctgttcgaaaccgacgaacttatgaaccaactctagatata
gaaaattttggattatcaaaagatgacctagaaactcaatttgatgctggtgaagtcatt
ggtttgggaaatacatcattaaaaaacataatttataaacttgaagaagtttattgcgat
tctattggtgttgaatatatgtacattcgtaaaccagaaattattaaatggtggcaggat
aaattaaatgaaaataacaatcacccaaaatattctgttgaatccaaaaaatatatcctt
tcaaaacttaatcaagctgtaacatttgaaaattttcttcaaacaaaatatgtaggtcaa
aaacgtttctcacttgaaggaggtgaatcacttattcctgctataagtgtagttcttttc
aacgcagttcttgattatgatgttaaagaatgtgttttaggaatggcacatcgtggtcgt
ttaagtacattagttaatatttttagaaaaccattcaatgaactttttagcgaattcgaa
ggaaaagattttgaagatgaagatattgatggtgatgtaaaatatcacttaggtttaaca
ttagataaaacatatcaaaatggaaaaactttaaaaatgaatttagtacctaatccttct
catctggaaactgttgctcctgttgccgaaggtattactcgtgctaaaattgataaagat
tataacggtgatgactctaaaatactcccaattattgtacatggtgatgctgcaattgct
ggacaaggtattgcgtatgaagtaattcaaatgagccaattaaatggttataagactgga
ggaacaattcacattgttgttaataatcaaattggatttactacaaattatttagacgcc
cgttcaagcacttattgtactgatgttggtaaagtaaccttatctccagtacttcatgta
aatgctgatgacgcagaagcagttgtacatgctgtagaattggcagtagattatagaatg
aaattcaaaagagatattttcattgatttgctaggttacagaaaatatggacataatgaa
ggtgatgaacctcgtttcacacagccaaaattatacaaagcgatttctaaacacagtaat
cctttaaaaatttatacagataaacttattgcagaaggaactatcgatgaagcatattct
aaaaaaatagttgctgacttcaaagaaaaactagaagaagaatatacaatttctaaagaa
tcagattcttccaaagttcgtgaatttatggaagaacgctggacagattttaaccgtcaa
aaattagacggtatgttaaaatctgttgatagtacatacccttctgaaaatcttaaaaat
atagctaaagttgtttcaactgttcctaaaggtgtaaaatttgttcgtaaagctgaaaga
attttagcaggaagagcagatatggtttttaaaaccgatactcttgattggggaatggca
gaaacattggcttatggtagtttattagaagagggttttgatgttcgtatttctggacaa
gatgttgaaagaggaacattctcacatcgacatgcaattttacgtgatgaaatttcagaa
gaacgtattaacttactaaacacaaatccttttaataaaggtgaaatgtatatttacaat
tctttattatcagaatatggagttttaggatttgattatggctatgcaatggccaatcca
aatacattaactatttgggaagcacagtttggagattttagtaatggtgctcaaatcata
tttgaccaatacttatctgctgctgaggacaaatggaaaatgcaaaacggaatcgtagtt
ttattacctcacggttatgaaagtcaaggttcagagcattcatcagcaagaatggaacga
tacttacaaatgtgtggtgttgacaatatgattgttgctgattgtacaactccggcaaac
ttttttcacttgcttcgtcgacaaatgaagcgtgattttagaaaaccattaatagtatta
actccaaaaagtttattgcgtcatcctaaagctgtttcatcgattggtgaattagaaaac
ggacaatttcaagaagtgattgatgatacaatcaatcctgacaaagtaaaaaaattagtt
ttctgtaccggtaaattctattatgatttattaacggaaagagaaagtttaaaaagagat
gatgttgctttggtaaggattgaacaattattcccattacacgaagaaaaaatacaaaaa
gtaatagatcgatataaaaatgttgaaaaatatgtttgggcacaagaagaacctaaaaat
atgggtgcttggagttatatgttgcagcgttttgaattagtaaaattagaagttgcctca
agaccttatgcttctgttcctgcaccaggctcaagcacaagagataaaaagagacaaaga
caagttattgatagtgtatttgacaccacaagtaaataa

DBGET integrated database retrieval system