KEGG   Lipotes vexillifer (Yangtze River dolphin): 103071760
Entry
103071760         CDS       T03090                                 

Gene name
MMP2
Definition
(RefSeq) matrix metallopeptidase 2
  KO
K01398  matrix metalloproteinase-2 (gelatinase A) [EC:3.4.24.24]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve01522  Endocrine resistance
lve04670  Leukocyte transendothelial migration
lve04912  GnRH signaling pathway
lve04915  Estrogen signaling pathway
lve04926  Relaxin signaling pathway
lve04933  AGE-RAGE signaling pathway in diabetic complications
lve05200  Pathways in cancer
lve05205  Proteoglycans in cancer
lve05219  Bladder cancer
lve05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lve00001]
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    103071760 (MMP2)
  09152 Endocrine system
   04912 GnRH signaling pathway
    103071760 (MMP2)
   04915 Estrogen signaling pathway
    103071760 (MMP2)
   04926 Relaxin signaling pathway
    103071760 (MMP2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103071760 (MMP2)
   05205 Proteoglycans in cancer
    103071760 (MMP2)
  09162 Cancer: specific types
   05219 Bladder cancer
    103071760 (MMP2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103071760 (MMP2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103071760 (MMP2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103071760 (MMP2)
Enzymes [BR:lve01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.24  gelatinase A
     103071760 (MMP2)
Peptidases and inhibitors [BR:lve01002]
 Metallo peptidases
  Family M10
   103071760 (MMP2)
SSDB
Motif
Pfam: Peptidase_M10 fn2 Hemopexin PG_binding_1 Reprolysin_5 Reprolysin_3 Peptidase_M66 Reprolysin_4
Other DBs
NCBI-GeneID: 103071760
NCBI-ProteinID: XP_007459512
UniProt: A0A340XHE3
LinkDB
Position
Un
AA seq 584 aa
MQKFFGLPQTGELDQGTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLD
PETVDDAFARAFRVWSDVTPLRFSRTHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFA
PGPGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYTSCTDTGRSDGF
LWCSTTYDFDKDGKYGFCPHEALFTMGGNADGQPCKFPFRFQGTSYDSCTTEGRTDGYRW
CGTTEDFDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKHESCTSTGRSDGKLWCA
TTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSEDPGALMAPIYTYTKNFRLSHD
DIKGIQELYGASPDIDTGTGPTPTLGPITPEICKQDIVFDGISQIRGEIFFFKDRFIWRT
VTPRDKPMGPLLVATFWSELPEKIDAVYEAPQEEKAVFFAGNEYWVYSASTLERGYPKPL
TSLGLPPDVQKVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDN
LDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC
NT seq 1755 nt   +upstreamnt  +downstreamnt
atgcagaagttcttcgggctgccccagacgggtgaactggaccagggcaccatcgagacc
atgcggaagccgcgctgcggcaaccccgacgtggccaactacaatttcttcccccgcaag
cccaagtgggacaagaaccagatcacctacaggatcattggctacacccctgatctggac
cccgagacagtggacgatgccttcgctcgtgccttccgagtctggagtgatgtgactcca
ctgcggttttctcggacccatgacggagaagctgacatcatgatcaactttggccgctgg
gagcatggagatgggtacccttttgatggcaaagacgggcttctggctcacgccttcgcc
ccaggccctggcgttgggggagactctcactttgatgacgatgagctttggaccctggga
gaagggcaagtggtccgcgtgaagtatgggaacgccgacggggagtactgcaagttcccc
ttcctgttcaacggcaaggagtacaccagctgcacggacacgggccgcagcgacggcttc
ctctggtgttccaccacctacgacttcgacaaggatggcaagtacggcttctgcccccat
gaagccctgttcaccatgggtggcaacgccgacggacagccctgcaagttcccgttccgc
ttccagggtacatcctatgacagctgcaccacggagggccgtaccgatggctaccgctgg
tgtggcaccaccgaggactttgaccgtgacaagaagtacggcttctgccccgagaccgcc
atgtctactgtgggcgggaactcggaaggtgccccctgtgtcttccccttcaccttcctg
ggcaacaagcacgagagctgcaccagcaccggccgcagcgatgggaagttgtggtgtgcg
accacggccaactacgacgatgaccgcaagtggggcttctgccctgaccaagggtacagc
ctgttccttgtggcagcccatgagtttggccatgcaatggggctggaacactcagaggat
cccggagccctaatggcccccatttacacctacaccaagaacttccgcctgtcacatgat
gacatcaagggcattcaagagctctatggggcctcccccgacattgacactggcaccggt
cccacgcccacactgggccccatcactcctgagatctgcaaacaggacatcgtctttgat
ggcatctctcagatccgtggggagatcttcttcttcaaggaccggttcatttggcgaaca
gtgacaccacgtgacaagcccatggggcccctgctggtggccacattctggtctgagctc
ccggaaaagatcgatgctgtatacgaggccccacaggaggagaaggctgtattctttgca
gggaatgaatactgggtctattcagccagcaccctggagcgagggtaccccaagccgctg
accagcttggggcttccccctgatgtccaaaaagtggatgctgcctttaactggagcaag
aacaagaagacgtacatcttcgctggagacaagttctggagatacaatgaggtgaagaag
aaaatggatcccggcttccccaagctcatcgcagatgcctggaacgccatccctgataac
ctggatgccgtggtggacctgcagggcgggggtcacagctacttcttcaagggcgcgtat
tacctgaagctggagaaccaaagtctgaagagcgtgaagttcggaagcatcaagtccgac
tggctgggctgctga

DBGET integrated database retrieval system