KEGG   Lipotes vexillifer (Yangtze River dolphin): 103087304
Entry
103087304         CDS       T03090                                 

Gene name
RELA
Definition
(RefSeq) RELA proto-oncogene, NF-kB subunit
  KO
K04735  transcription factor p65
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve01523  Antifolate resistance
lve04010  MAPK signaling pathway
lve04014  Ras signaling pathway
lve04024  cAMP signaling pathway
lve04062  Chemokine signaling pathway
lve04064  NF-kappa B signaling pathway
lve04066  HIF-1 signaling pathway
lve04071  Sphingolipid signaling pathway
lve04137  Mitophagy - animal
lve04151  PI3K-Akt signaling pathway
lve04210  Apoptosis
lve04211  Longevity regulating pathway
lve04218  Cellular senescence
lve04380  Osteoclast differentiation
lve04620  Toll-like receptor signaling pathway
lve04621  NOD-like receptor signaling pathway
lve04622  RIG-I-like receptor signaling pathway
lve04623  Cytosolic DNA-sensing pathway
lve04625  C-type lectin receptor signaling pathway
lve04657  IL-17 signaling pathway
lve04658  Th1 and Th2 cell differentiation
lve04659  Th17 cell differentiation
lve04660  T cell receptor signaling pathway
lve04662  B cell receptor signaling pathway
lve04668  TNF signaling pathway
lve04722  Neurotrophin signaling pathway
lve04917  Prolactin signaling pathway
lve04920  Adipocytokine signaling pathway
lve04926  Relaxin signaling pathway
lve04931  Insulin resistance
lve04932  Non-alcoholic fatty liver disease
lve04933  AGE-RAGE signaling pathway in diabetic complications
lve05010  Alzheimer disease
lve05022  Pathways of neurodegeneration - multiple diseases
lve05030  Cocaine addiction
lve05132  Salmonella infection
lve05133  Pertussis
lve05134  Legionellosis
lve05135  Yersinia infection
lve05140  Leishmaniasis
lve05142  Chagas disease
lve05145  Toxoplasmosis
lve05146  Amoebiasis
lve05152  Tuberculosis
lve05160  Hepatitis C
lve05161  Hepatitis B
lve05162  Measles
lve05163  Human cytomegalovirus infection
lve05164  Influenza A
lve05165  Human papillomavirus infection
lve05166  Human T-cell leukemia virus 1 infection
lve05167  Kaposi sarcoma-associated herpesvirus infection
lve05168  Herpes simplex virus 1 infection
lve05169  Epstein-Barr virus infection
lve05170  Human immunodeficiency virus 1 infection
lve05200  Pathways in cancer
lve05202  Transcriptional misregulation in cancer
lve05203  Viral carcinogenesis
lve05212  Pancreatic cancer
lve05215  Prostate cancer
lve05220  Chronic myeloid leukemia
lve05221  Acute myeloid leukemia
lve05222  Small cell lung cancer
lve05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
lve05321  Inflammatory bowel disease
lve05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103087304 (RELA)
   04014 Ras signaling pathway
    103087304 (RELA)
   04064 NF-kappa B signaling pathway
    103087304 (RELA)
   04668 TNF signaling pathway
    103087304 (RELA)
   04066 HIF-1 signaling pathway
    103087304 (RELA)
   04071 Sphingolipid signaling pathway
    103087304 (RELA)
   04024 cAMP signaling pathway
    103087304 (RELA)
   04151 PI3K-Akt signaling pathway
    103087304 (RELA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    103087304 (RELA)
  09143 Cell growth and death
   04210 Apoptosis
    103087304 (RELA)
   04218 Cellular senescence
    103087304 (RELA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103087304 (RELA)
   04621 NOD-like receptor signaling pathway
    103087304 (RELA)
   04622 RIG-I-like receptor signaling pathway
    103087304 (RELA)
   04623 Cytosolic DNA-sensing pathway
    103087304 (RELA)
   04625 C-type lectin receptor signaling pathway
    103087304 (RELA)
   04660 T cell receptor signaling pathway
    103087304 (RELA)
   04658 Th1 and Th2 cell differentiation
    103087304 (RELA)
   04659 Th17 cell differentiation
    103087304 (RELA)
   04657 IL-17 signaling pathway
    103087304 (RELA)
   04662 B cell receptor signaling pathway
    103087304 (RELA)
   04062 Chemokine signaling pathway
    103087304 (RELA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103087304 (RELA)
   04917 Prolactin signaling pathway
    103087304 (RELA)
   04926 Relaxin signaling pathway
    103087304 (RELA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103087304 (RELA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103087304 (RELA)
  09149 Aging
   04211 Longevity regulating pathway
    103087304 (RELA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103087304 (RELA)
   05202 Transcriptional misregulation in cancer
    103087304 (RELA)
   05203 Viral carcinogenesis
    103087304 (RELA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103087304 (RELA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    103087304 (RELA)
   05221 Acute myeloid leukemia
    103087304 (RELA)
   05220 Chronic myeloid leukemia
    103087304 (RELA)
   05215 Prostate cancer
    103087304 (RELA)
   05222 Small cell lung cancer
    103087304 (RELA)
  09163 Immune disease
   05321 Inflammatory bowel disease
    103087304 (RELA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103087304 (RELA)
   05022 Pathways of neurodegeneration - multiple diseases
    103087304 (RELA)
  09165 Substance dependence
   05030 Cocaine addiction
    103087304 (RELA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103087304 (RELA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103087304 (RELA)
   04931 Insulin resistance
    103087304 (RELA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103087304 (RELA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103087304 (RELA)
   05135 Yersinia infection
    103087304 (RELA)
   05133 Pertussis
    103087304 (RELA)
   05134 Legionellosis
    103087304 (RELA)
   05152 Tuberculosis
    103087304 (RELA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103087304 (RELA)
   05170 Human immunodeficiency virus 1 infection
    103087304 (RELA)
   05162 Measles
    103087304 (RELA)
   05164 Influenza A
    103087304 (RELA)
   05161 Hepatitis B
    103087304 (RELA)
   05160 Hepatitis C
    103087304 (RELA)
   05168 Herpes simplex virus 1 infection
    103087304 (RELA)
   05163 Human cytomegalovirus infection
    103087304 (RELA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103087304 (RELA)
   05169 Epstein-Barr virus infection
    103087304 (RELA)
   05165 Human papillomavirus infection
    103087304 (RELA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103087304 (RELA)
   05145 Toxoplasmosis
    103087304 (RELA)
   05140 Leishmaniasis
    103087304 (RELA)
   05142 Chagas disease
    103087304 (RELA)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    103087304 (RELA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lve03000]
    103087304 (RELA)
Transcription factors [BR:lve03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    103087304 (RELA)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 103087304
NCBI-ProteinID: XP_007462051
UniProt: A0A340XKW6
LinkDB
Position
Un
AA seq 560 aa
MWACADPCLPLLSDLFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGE
RSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRC
IHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPVEEQRGDYDLNAVRLCFQVTVRDPA
GRPLRLSPALSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFT
GPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYL
PDTDDRHRIEEKRKRTYETFKSIMKKSPFNGPTDHRPPTRRIAVPSRSSTSVPKPPPQPY
PFTPSLSTINFEEFSPMVFPSGQISSQTSALAPAPALVLAQAPAPAPAMASALAQAPAPV
LAPGLAQAVTPPAPKTNPAGEGTLTEALLQLQFDADEDLGALLGNSTDPAVFTDLASVDN
SEFQQLLNQGVPMAPHTAEPMLMEYPEAITRLVTGSQRPPDPAPTPLGASGLTNGLLSGD
EDFSSIADMDFSALLSQISS
NT seq 1683 nt   +upstreamnt  +downstreamnt
atgtgggcttgtgctgacccttgtctccctctcctttcagacctcttccccctcatcttc
cccgcggagccggcccaggcctccggcccctacgtggagatcatcgagcagcccaagcag
cggggcatgcgctttcgctacaagtgtgagggccgctcagcaggcagtatcccaggcgag
aggagcacagataccaccaagacccaccctaccatcaagatcaatggctacacggggcca
gggacagtccgcatctccctggtgaccaaggacccccctcaccggcctcacccccatgag
cttgtggggaaagactgccgggatggcttctatgaggctgagctctgcccggaccgctgc
atccacagcttccagaacctggggatccagtgtgtaaagaagcgggacctggagcaggcc
atcagtcagcgcatccagaccaacaacaaccccttccaagttcccgtagaggagcagcgt
ggggactacgacctgaatgctgtccggctctgcttccaggtgacagtgcgggacccggca
ggcaggcccctacgcctgtcgcctgccctctcccatcccatctttgacaaccgcgccccc
aacactgccgagctcaagatctgccgagtgaatcggaactctgggagctgccttgggggg
gatgagatcttcctgctgtgtgacaaggtgcagaaagaggatatcgaggtgtatttcacg
ggaccaggctgggaggcccgaggctccttttcacaagctgatgtgcaccggcaagtggcc
attgtgttccggacgcccccctacgcggaccccagcctgcaggcccctgtgcgcgtctcc
atgcagctgcggcggccttccgatcgggagctcagcgaacccatggaattccagtacttg
ccagacacagatgatcgtcaccggatcgaggagaaacgcaaaaggacgtatgagaccttt
aagagcatcatgaaaaagagccctttcaatggacccaccgaccaccggcctccgacccgg
cgcatcgctgtgccttcccgcagctcaacttccgtccccaagccacctccccagccctat
ccctttacaccatctctcagcaccatcaactttgaggagttctcccccatggtctttcct
tctgggcagatctcaagccagacctcggccttggcaccggcccctgccctagtcctggcc
caggccccagcccctgccccagccatggcatcagccctggcccaggccccagccccagtc
ctagccccaggccttgctcaggctgtgaccccacctgcccccaagactaacccggctggg
gaagggacactgacagaggctctgctgcagctgcagtttgatgctgatgaagacctgggg
gccctgctcggcaatagcacagatccagccgtgttcacagacctggcatccgtcgacaac
tctgagtttcagcagctactgaaccagggtgtacccatggccccccatacagctgagccc
atgctgatggagtaccctgaggctataactcgtctggtgacagggtcccagaggccccct
gacccagctcccactcccctgggagcctctggcctcaccaacggcctcctctcaggggat
gaagacttctcctccattgcggacatggacttctcagcccttctaagtcagatcagctcc
taa

DBGET integrated database retrieval system