KEGG   Monopterus albus (swamp eel): 109974134
Entry
109974134         CDS       T05607                                 

Gene name
cdkn1b
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04012  ErbB signaling pathway
malb04068  FoxO signaling pathway
malb04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109974134 (cdkn1b)
   04068 FoxO signaling pathway
    109974134 (cdkn1b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109974134 (cdkn1b)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 109974134
NCBI-ProteinID: XP_020479827
LinkDB
Position
Unknown
AA seq 177 aa
MSDVRLSNGSPTLERTDPRVSDHPKPSACRSLFGSVDHEELKRDLKGHLREMDEAASAKW
SFDFANHTPLANGRLEWELVDCRDIPDFYSRQPRRRKAVCSAGNNNVDLNGNHNCVVVAP
SEDTEMEQYTGLRKRAACHDPPAQSKRSHTSSDEVSCPGLSLSTEHTPRKTSPKRQT
NT seq 534 nt   +upstreamnt  +downstreamnt
atgtcagatgttcgactttcaaacgggagtccgacgttggagcggacggatccccgggtg
tcggatcacccgaaaccatcagcctgcaggagcctcttcggctcggtggatcacgaagag
ttaaagagagatttaaagggacacttgcgggagatggacgaggctgcctccgccaagtgg
agcttcgacttcgccaatcacacaccgctggccaacggcaggctcgagtgggaattagtg
gattgcagagacatcccggatttctacagcaggcagccgcggaggaggaaggccgtgtgc
tccgctgggaataacaatgtggatctaaatgggaatcataactgtgttgtggtggctccg
agcgaagataccgagatggagcagtacaccgggctgaggaaaagagctgcatgccacgac
cccccggcccaaagtaagaggtcacacaccagctcagatgaagtgagctgtccaggtctg
agcctttctacagaacacacgcccagaaagaccagtcccaagaggcaaacgtga

DBGET integrated database retrieval system