KEGG   Mus caroli (Ryukyu mouse): 110285481
Entry
110285481         CDS       T05910                                 

Gene name
Bad
Definition
(RefSeq) bcl2-associated agonist of cell death isoform X1
  KO
K02158  Bcl-2-antagonist of cell death
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01521  EGFR tyrosine kinase inhibitor resistance
mcal01522  Endocrine resistance
mcal01524  Platinum drug resistance
mcal04012  ErbB signaling pathway
mcal04014  Ras signaling pathway
mcal04022  cGMP-PKG signaling pathway
mcal04024  cAMP signaling pathway
mcal04062  Chemokine signaling pathway
mcal04140  Autophagy - animal
mcal04151  PI3K-Akt signaling pathway
mcal04210  Apoptosis
mcal04370  VEGF signaling pathway
mcal04510  Focal adhesion
mcal04722  Neurotrophin signaling pathway
mcal04910  Insulin signaling pathway
mcal04919  Thyroid hormone signaling pathway
mcal05010  Alzheimer disease
mcal05014  Amyotrophic lateral sclerosis
mcal05020  Prion disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05145  Toxoplasmosis
mcal05152  Tuberculosis
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05162  Measles
mcal05165  Human papillomavirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05200  Pathways in cancer
mcal05203  Viral carcinogenesis
mcal05210  Colorectal cancer
mcal05211  Renal cell carcinoma
mcal05212  Pancreatic cancer
mcal05213  Endometrial cancer
mcal05215  Prostate cancer
mcal05218  Melanoma
mcal05220  Chronic myeloid leukemia
mcal05221  Acute myeloid leukemia
mcal05223  Non-small cell lung cancer
mcal05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110285481 (Bad)
   04014 Ras signaling pathway
    110285481 (Bad)
   04370 VEGF signaling pathway
    110285481 (Bad)
   04024 cAMP signaling pathway
    110285481 (Bad)
   04022 cGMP-PKG signaling pathway
    110285481 (Bad)
   04151 PI3K-Akt signaling pathway
    110285481 (Bad)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110285481 (Bad)
  09143 Cell growth and death
   04210 Apoptosis
    110285481 (Bad)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110285481 (Bad)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    110285481 (Bad)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110285481 (Bad)
   04919 Thyroid hormone signaling pathway
    110285481 (Bad)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110285481 (Bad)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110285481 (Bad)
   05203 Viral carcinogenesis
    110285481 (Bad)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110285481 (Bad)
   05212 Pancreatic cancer
    110285481 (Bad)
   05225 Hepatocellular carcinoma
    110285481 (Bad)
   05221 Acute myeloid leukemia
    110285481 (Bad)
   05220 Chronic myeloid leukemia
    110285481 (Bad)
   05218 Melanoma
    110285481 (Bad)
   05211 Renal cell carcinoma
    110285481 (Bad)
   05215 Prostate cancer
    110285481 (Bad)
   05213 Endometrial cancer
    110285481 (Bad)
   05223 Non-small cell lung cancer
    110285481 (Bad)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110285481 (Bad)
   05014 Amyotrophic lateral sclerosis
    110285481 (Bad)
   05020 Prion disease
    110285481 (Bad)
   05022 Pathways of neurodegeneration - multiple diseases
    110285481 (Bad)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110285481 (Bad)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110285481 (Bad)
   05161 Hepatitis B
    110285481 (Bad)
   05160 Hepatitis C
    110285481 (Bad)
   05162 Measles
    110285481 (Bad)
   05168 Herpes simplex virus 1 infection
    110285481 (Bad)
   05165 Human papillomavirus infection
    110285481 (Bad)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110285481 (Bad)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110285481 (Bad)
   01524 Platinum drug resistance
    110285481 (Bad)
   01522 Endocrine resistance
    110285481 (Bad)
SSDB
Motif
Pfam: Bcl-2_BAD Bclx_interact
Other DBs
NCBI-GeneID: 110285481
NCBI-ProteinID: XP_021007328
Ensembl: MGP_CAROLIEiJ_G0022620
UniProt: A0A6P5P0S6
LinkDB
Position
19
AA seq 326 aa
MDRQLLMFEDYHFPRLDSQTHIAFGVPIWGRQRLPRTGSLKETSAHNQDGTRTPPPSFCL
QAPRSGLGQRTHTYLGSRAPWSPTARLPGRPCPFFRTRAAILPERSSRNGAGGCPQDGQC
KASTIGKKELVFPSRSLGPEGAITIATTIASDGRASVNGSITQSMFQIPEFEPSEQEDAS
ATDRGLGPSLTEDQPGPYLAPGLLGSIVHQQGRAATNSHHGGAGAMETRSRHSSYPAGTE
EDEGMEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSFKGLPRPKSAGTAAQMR
QSTSWTRIIQSWWDRNLGKGGSTPSQ
NT seq 981 nt   +upstreamnt  +downstreamnt
atggaccgccagctcttaatgtttgaggactaccatttcccacgcttagattcccaaacc
cacatcgcgttcggcgtgcccatatgggggcggcaacgacttccccgcacagggtcactg
aaggaaacttccgcccacaaccaagatggtacccggaccccgccccctagcttctgtctg
caggccccgcgctccggcctggggcagcgtacgcacacctatcttggcagcagagcccct
tggagccccacggctcgccttcctgggcgcccctgtcctttcttccgcacccgggcggcc
atcctgccggaaaggagctcccgaaatggcgcggggggttgtccccaagacgggcagtgc
aaggcctccacgatcgggaagaaggagctggtcttcccatcccggtcactcggtccagag
ggagcaataaccatcgcaacgaccattgcatccgacggccgagcttcagtgaacggctct
ataacccagagtatgttccagatcccagagtttgagccgagtgagcaggaagacgctagt
gctacagataggggcctgggccctagcctcactgaggaccagccaggtccctacctggcc
ccaggtctcctggggagcatcgttcatcagcagggacgggcagccaccaacagtcatcat
ggaggcgctggggctatggagactcggagtcgccacagttcgtacccagcggggaccgag
gaggatgaagggatggaggaggagcttagcccttttcgaggacgctcgcgttccgctccc
cccaatctctgggcagcgcagcgctacggccgtgagctccgaaggatgagcgatgagttt
gagggttccttcaagggacttcctcgcccaaagagcgcaggcactgcagcacagatgcga
caaagcaccagctggacgcgcattatccagtcctggtgggatcgaaacttgggcaaagga
ggctccaccccctcccagtga

DBGET integrated database retrieval system