KEGG   Mus caroli (Ryukyu mouse): 110285589
Entry
110285589         CDS       T05910                                 

Gene name
Frat1
Definition
(RefSeq) proto-oncogene FRAT1
  KO
K03069  frequently rearranged in advanced T-cell lymphomas 1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04310  Wnt signaling pathway
mcal05010  Alzheimer disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05200  Pathways in cancer
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110285589 (Frat1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110285589 (Frat1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110285589 (Frat1)
   05226 Gastric cancer
    110285589 (Frat1)
   05224 Breast cancer
    110285589 (Frat1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110285589 (Frat1)
   05022 Pathways of neurodegeneration - multiple diseases
    110285589 (Frat1)
SSDB
Motif
Pfam: GSK-3_bind
Other DBs
NCBI-GeneID: 110285589
NCBI-ProteinID: XP_021007516
UniProt: A0A6P5NW44
LinkDB
Position
19
AA seq 274 aa
MPCRREEEEEAGEEAEGEEDDDSFLLLQQSVTLGGSTDVDQLIVQIGETLQLDSAHDRPA
SPCAAPGPPPPQVLAALPADKTGTPARRLLRPTGSAETGNPAPPGAVRCVLGERGRVRGR
SAPYCVAEISPGASALPQQPGLDGPPGTGKLSTPQPLSGPCRRGWLRNAAASRRLQQRRG
SQPETRTGDDDDPHRLLQQLVLSGNLIKEAVRRLHSRRLQLHAKLPAHPFLGPLSAPVHE
PPSPGSPRAACSDPGACMGRAQLRTGDDLLVPGS
NT seq 825 nt   +upstreamnt  +downstreamnt
atgccttgccggagggaggaggaggaggaagccggcgaagaggcggagggggaggaggac
gacgacagcttcctcctgctgcagcagtcggtgactctgggcggctcgaccgacgtggac
cagctcatcgtccagatcggcgagacgctgcagctggactcggcgcacgatcgcccggcc
tcgccgtgtgccgccccgggtcccccacccccgcaggtcctggcggcgctgccggcggac
aagaccgggaccccagctaggaggctgcttcggccgacggggtcagcggagaccgggaac
cctgcgcccccgggggccgtgcgctgcgtgctaggggagcgcgggcgcgtgcggggccgg
tcggcgccctactgcgttgcggagatctcccccggcgccagcgcgctgccccagcagccg
ggccttgacggacccccggggaccggcaaactaagcaccccgcagccactgtcgggcccg
tgccgccggggttggctccggaacgcagccgcgtcccgccgcttgcaacagcgacgcgga
tctcagccggagacccgcactggcgacgacgacgacccgcaccggctcctgcagcagctc
gtgctctcgggaaacctcatcaaggaggcggtgcgcagacttcattcgcgacggctacag
ttacacgcaaagctccccgcacacccgttcctcgggcctctgtcagccccggtgcatgag
ccgccttcgcccgggagccctcgcgcggcctgcagcgaccctggcgcttgcatggggagg
gcgcagctcagaactggggacgaccttcttgtccctggcagctaa

KEGG   Mus caroli (Ryukyu mouse): 110285818
Entry
110285818         CDS       T05910                                 

Gene name
Frat2
Definition
(RefSeq) GSK-3-binding protein FRAT2
  KO
K03096  frequently rearranged in advanced T-cell lymphomas 2
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04310  Wnt signaling pathway
mcal05010  Alzheimer disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05200  Pathways in cancer
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110285818 (Frat2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110285818 (Frat2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110285818 (Frat2)
   05226 Gastric cancer
    110285818 (Frat2)
   05224 Breast cancer
    110285818 (Frat2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110285818 (Frat2)
   05022 Pathways of neurodegeneration - multiple diseases
    110285818 (Frat2)
SSDB
Motif
Pfam: GSK-3_bind PRIMA1
Other DBs
NCBI-GeneID: 110285818
NCBI-ProteinID: XP_021007916
Ensembl: MGP_CAROLIEiJ_G0022956
UniProt: A0A6P5NWZ6
LinkDB
Position
19
AA seq 231 aa
MPCRREEEEEAGEEAEGEEDDDSFLLLQQSVTLGGSTDVDRLIAQIGETLQLDAAHDRPA
SPCATPGPPPAPPRVLAALSADKTGTPARRLLRPTGSAETGDPAPPGAVRCVLGERGRVR
GRSAPYCVAEIAPGASALPGPGRRGWLPGSVASHRIQQRRWTAGGARAADDDPHRLLQQL
VLSGNLIKEAVRRLQRAVAAVAATSPANAPGSGGGRSGPDSVTLQPSGAWL
NT seq 696 nt   +upstreamnt  +downstreamnt
atgccttgccggagggaggaggaggaggaagccggcgaagaggcggagggggaggaggac
gacgacagcttcctcctgctgcagcagtcggtgactctgggcggctcgaccgacgtggat
cggctcatcgcccagatcggcgagacgctgcagctggacgcggcgcacgatcgcccggct
tcgccgtgtgccaccccgggtcccccacccgcgcccccgcgggtcctggcggcgctgtcg
gcggataagaccgggaccccagcgaggcggctgctgcggccgacggggtcagcggagacc
ggggaccctgcgcctcccggggccgtgcgctgcgtgctgggggagcgcgggcgtgtgcgg
ggccggtcggcgccctactgcgttgcggagatcgccccgggcgccagcgcgcttcccggg
ccggggcggcgagggtggctccccggctcggtggcttctcaccgaatccagcagcggcgg
tggacagcaggcggagcgcgcgcggccgacgacgacccgcaccggctcctgcagcagctc
gtgctctccggaaacctcatcaaggaggcggtgcgcagactccagcgagcggtcgccgcg
gtggcggccacgagccccgcgaacgctccggggtccgggggtggccgaagcggaccggac
tcagtcactctgcagccctcgggcgcctggctctga

KEGG   Mus caroli (Ryukyu mouse): 110299413
Entry
110299413         CDS       T05910                                 

Definition
(RefSeq) proto-oncogene FRAT1-like
  KO
K03069  frequently rearranged in advanced T-cell lymphomas 1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04310  Wnt signaling pathway
mcal05010  Alzheimer disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05200  Pathways in cancer
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110299413
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110299413
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110299413
   05226 Gastric cancer
    110299413
   05224 Breast cancer
    110299413
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110299413
   05022 Pathways of neurodegeneration - multiple diseases
    110299413
SSDB
Motif
Pfam: GSK-3_bind
Other DBs
NCBI-GeneID: 110299413
NCBI-ProteinID: XP_021024758
Ensembl: MGP_CAROLIEiJ_G0029820
UniProt: A0A6P5Q5E8
LinkDB
Position
7
AA seq 283 aa
MPCRREEEAGDEAEGEEDDNSFLLLQQSVTLGGSADVDRLIAQIGETLQLDAGHDGPASP
CAAPGPPPAPPRVLAALPADKAGAPARRLLRRAASAEAGDPAPPGAVRCVLGERGRLRGR
AAPYCVAEIAPGASALPQQFGLEVSPGMGKVSIPQPLSSRCRRGWLRNAAASRRQQQRRG
SQSETRTSDGDPPRLLQQLLLSGNLIKEAVRRLHSRGLQLQAKLPAHSFLGPLSAPVQEP
PLPASPRAACSDPGDCDGGYSSELGTTFLSLAANNPGGHSTNL
NT seq 852 nt   +upstreamnt  +downstreamnt
atgccgtgccggagggaagaggaagccggcgacgaggcggagggggaggaggacgacaac
agcttcctcctgctgcagcagtccgtgactctggggggctctgccgacgtggaccggctc
atcgcccagatcggcgagacgctgcagctggacgcgggacacgatggcccggcctcgcca
tgtgctgccccgggccccccgcccgcgcccccgcgggtcctggccgcgctgccggcggac
aaggccggggccccagcgaggcggctgctgcggcgagcagcatcagcggaggccggggac
cctgcgcccccgggggccgtgcgctgcgtgctgggggagcgcgggcgcctgcggggccgg
gcggcgccctactgtgtggcggagatcgccccgggtgccagcgcgctgccccagcagttc
ggccttgaggtatccccggggatgggcaaagtaagcatcccgcagccactgtccagccgg
tgccggcggggttggctccggaacgcagccgcgtcccgccgccagcaacagcgacgcgga
tctcagtcggagacccgcacgagtgacggcgacccgccccgactcctgcagcagctcctt
ctttcgggaaacctcatcaaggaggcagtgcggagacttcattctcgagggctgcagcta
caggcaaagcttcccgctcattcgttcctcgggcctttgtcagccccggtgcaggagccg
cctttgcccgcgagcccccgcgcagcctgcagcgatcctggcgattgtgatggagggtac
agctcagaactagggacgaccttcttgtccctggcagctaataaccccggtggccacagc
accaacctgtag

DBGET integrated database retrieval system