KEGG   Mus caroli (Ryukyu mouse): 110286053
Entry
110286053         CDS       T05910                                 

Definition
(RefSeq) insulin-1
  KO
K04526  insulin
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04022  cGMP-PKG signaling pathway
mcal04066  HIF-1 signaling pathway
mcal04068  FoxO signaling pathway
mcal04072  Phospholipase D signaling pathway
mcal04114  Oocyte meiosis
mcal04140  Autophagy - animal
mcal04150  mTOR signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04152  AMPK signaling pathway
mcal04211  Longevity regulating pathway
mcal04213  Longevity regulating pathway - multiple species
mcal04810  Regulation of actin cytoskeleton
mcal04910  Insulin signaling pathway
mcal04911  Insulin secretion
mcal04913  Ovarian steroidogenesis
mcal04914  Progesterone-mediated oocyte maturation
mcal04917  Prolactin signaling pathway
mcal04923  Regulation of lipolysis in adipocytes
mcal04930  Type II diabetes mellitus
mcal04931  Insulin resistance
mcal04932  Non-alcoholic fatty liver disease
mcal04940  Type I diabetes mellitus
mcal04950  Maturity onset diabetes of the young
mcal04960  Aldosterone-regulated sodium reabsorption
mcal05010  Alzheimer disease
mcal05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110286053
   04014 Ras signaling pathway
    110286053
   04015 Rap1 signaling pathway
    110286053
   04066 HIF-1 signaling pathway
    110286053
   04068 FoxO signaling pathway
    110286053
   04072 Phospholipase D signaling pathway
    110286053
   04022 cGMP-PKG signaling pathway
    110286053
   04151 PI3K-Akt signaling pathway
    110286053
   04152 AMPK signaling pathway
    110286053
   04150 mTOR signaling pathway
    110286053
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110286053
  09143 Cell growth and death
   04114 Oocyte meiosis
    110286053
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110286053
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    110286053
   04910 Insulin signaling pathway
    110286053
   04923 Regulation of lipolysis in adipocytes
    110286053
   04913 Ovarian steroidogenesis
    110286053
   04914 Progesterone-mediated oocyte maturation
    110286053
   04917 Prolactin signaling pathway
    110286053
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    110286053
  09149 Aging
   04211 Longevity regulating pathway
    110286053
   04213 Longevity regulating pathway - multiple species
    110286053
 09160 Human Diseases
  09162 Cancer: specific types
   05215 Prostate cancer
    110286053
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110286053
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110286053
   04940 Type I diabetes mellitus
    110286053
   04950 Maturity onset diabetes of the young
    110286053
   04932 Non-alcoholic fatty liver disease
    110286053
   04931 Insulin resistance
    110286053
SSDB
Motif
Pfam: Insulin Ins_beta
Other DBs
NCBI-GeneID: 110286053
NCBI-ProteinID: XP_021008173
Ensembl: MGP_CAROLIEiJ_G0023067
UniProt: A0A6P5P2Y0
LinkDB
Position
19
AA seq 108 aa
MALLVRFLPLLALLALWEPKPTQAFVKQHLCGPHLVEALYLVCGERGFFYSPKSRREVED
PQVEQLELGGSPGDLQTLALEVARQKRGIVDQCCTSICSLYQLENYCN
NT seq 327 nt   +upstreamnt  +downstreamnt
atggccctgttggtgcgcttcctacccctgctggccctgcttgccctctgggagcctaaa
cctacccaggcttttgtcaaacagcatctctgtggtccccacctggtggaggctctctac
ctggtgtgtggggagcgtggcttcttctactcacccaagtcccgccgtgaagtggaagac
ccacaagtggaacaactggagctgggaggaagccccggggaccttcagaccttggcgttg
gaggtggcccgacagaagcgtggcattgtggatcagtgctgcaccagcatctgttccctc
taccagctggagaactactgcaactaa

KEGG   Mus caroli (Ryukyu mouse): 110299132
Entry
110299132         CDS       T05910                                 

Definition
(RefSeq) insulin-2
  KO
K04526  insulin
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04022  cGMP-PKG signaling pathway
mcal04066  HIF-1 signaling pathway
mcal04068  FoxO signaling pathway
mcal04072  Phospholipase D signaling pathway
mcal04114  Oocyte meiosis
mcal04140  Autophagy - animal
mcal04150  mTOR signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04152  AMPK signaling pathway
mcal04211  Longevity regulating pathway
mcal04213  Longevity regulating pathway - multiple species
mcal04810  Regulation of actin cytoskeleton
mcal04910  Insulin signaling pathway
mcal04911  Insulin secretion
mcal04913  Ovarian steroidogenesis
mcal04914  Progesterone-mediated oocyte maturation
mcal04917  Prolactin signaling pathway
mcal04923  Regulation of lipolysis in adipocytes
mcal04930  Type II diabetes mellitus
mcal04931  Insulin resistance
mcal04932  Non-alcoholic fatty liver disease
mcal04940  Type I diabetes mellitus
mcal04950  Maturity onset diabetes of the young
mcal04960  Aldosterone-regulated sodium reabsorption
mcal05010  Alzheimer disease
mcal05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110299132
   04014 Ras signaling pathway
    110299132
   04015 Rap1 signaling pathway
    110299132
   04066 HIF-1 signaling pathway
    110299132
   04068 FoxO signaling pathway
    110299132
   04072 Phospholipase D signaling pathway
    110299132
   04022 cGMP-PKG signaling pathway
    110299132
   04151 PI3K-Akt signaling pathway
    110299132
   04152 AMPK signaling pathway
    110299132
   04150 mTOR signaling pathway
    110299132
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110299132
  09143 Cell growth and death
   04114 Oocyte meiosis
    110299132
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110299132
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    110299132
   04910 Insulin signaling pathway
    110299132
   04923 Regulation of lipolysis in adipocytes
    110299132
   04913 Ovarian steroidogenesis
    110299132
   04914 Progesterone-mediated oocyte maturation
    110299132
   04917 Prolactin signaling pathway
    110299132
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    110299132
  09149 Aging
   04211 Longevity regulating pathway
    110299132
   04213 Longevity regulating pathway - multiple species
    110299132
 09160 Human Diseases
  09162 Cancer: specific types
   05215 Prostate cancer
    110299132
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110299132
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110299132
   04940 Type I diabetes mellitus
    110299132
   04950 Maturity onset diabetes of the young
    110299132
   04932 Non-alcoholic fatty liver disease
    110299132
   04931 Insulin resistance
    110299132
SSDB
Motif
Pfam: Insulin Ins_beta
Other DBs
NCBI-GeneID: 110299132
NCBI-ProteinID: XP_021024412
Ensembl: MGP_CAROLIEiJ_G0030729
UniProt: A0A6P5QAY7
LinkDB
Position
7
AA seq 110 aa
MALWMHFLPLVALLFLWESHPTQAFVKQHLCGSHLVEALYLVCGERGFFYTPMSRREVED
PQVAQLELGGGPGAGDLQTLALEVAQQKRGIVDQCCTSICSLYQLENYCN
NT seq 333 nt   +upstreamnt  +downstreamnt
atggccctgtggatgcacttcctgcccctggtggccctgctcttcctctgggagtcccac
cccacccaggcttttgtcaagcagcacctttgtggttcccatctggtggaggctctctac
ttggtgtgtggggagcgtggcttcttctacacacccatgtcccgccgtgaagtggaggac
ccacaagtggcacaactggagctgggtggaggcccgggagcaggtgaccttcagaccttg
gcactggaggtggcccagcagaagcgcggcattgtagatcagtgctgcaccagcatctgc
tccctctaccagctggagaactactgcaactag

DBGET integrated database retrieval system