KEGG   Mus caroli (Ryukyu mouse): 110294348
Entry
110294348         CDS       T05910                                 

Gene name
Rbpj
Definition
(RefSeq) recombining binding protein suppressor of hairless
  KO
K06053  recombining binding protein suppressor of hairless
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04330  Notch signaling pathway
mcal04658  Th1 and Th2 cell differentiation
mcal05017  Spinocerebellar ataxia
mcal05165  Human papillomavirus infection
mcal05169  Epstein-Barr virus infection
mcal05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    110294348 (Rbpj)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    110294348 (Rbpj)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110294348 (Rbpj)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    110294348 (Rbpj)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    110294348 (Rbpj)
   05165 Human papillomavirus infection
    110294348 (Rbpj)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110294348 (Rbpj)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Other transcription factors
   Others
    110294348 (Rbpj)
SSDB
Motif
Pfam: BTD LAG1-DNAbind TIG RHD_dimer
Other DBs
NCBI-GeneID: 110294348
NCBI-ProteinID: XP_021018177
Ensembl: MGP_CAROLIEiJ_G0027225
UniProt: A0A6P5PW37
LinkDB
Position
5
AA seq 487 aa
MAPVVTGKFGERPPPKRLTREAMRNYLKERGDQTVLILHAKVAQKSYGNEKRFFCPPPCV
YLMGSGWKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGKNYCTAKTLYISDS
DKRKHFMLSVKMFYGNSDDIGVFLSKRIKVISKPSKKKQSLKNADLCIASGTKVALFNRL
RSQTVSTRYLHVEGGNFHASSQQWGAFYIHLLDDDESEGEEFTVRDGYIHYGQTVKLVCS
VTGMALPRLIIRKVDKQTALLDADDPVSQLHKCAFYLKDTERMYLCLSQERIIQFQATPC
PKEQNKEMINDGASWTIISTDKAEYTFYEGMGPVLAPVTPVPVVESLQLNGGGDVAMLEL
TGQNFTPNLRVWFGDVEAETMYRCGESMLCVVPDISAFREGWRWVRQPVQVPVTLVRNDG
VIYSTSLTFTYTPEPGPRPHCSAAGAILRANSSQVPTNESNTNSEGNYTNASTNSTSVTS
STATVVS
NT seq 1464 nt   +upstreamnt  +downstreamnt
atggcgcctgttgtgacagggaagtttggtgagcggcctccacccaaacgactcactagg
gaagctatgcgaaattatttaaaagaacgaggggatcaaaccgtgctcattcttcatgca
aaagttgcacagaagtcttacgggaatgaaaaacgatttttttgccctcctccttgtgtg
tatcttatgggcagtggttggaagaaaaaaaaagagcaaatggaacgagatggttgttct
gaacaagagtctcaaccctgtgcatttattggaataggaaacagtgaccaagaaatgcag
cagctgaacttggaagggaagaactactgtacagccaaaacattgtacatatctgattca
gacaagagaaaacatttcatgttgtctgtaaagatgttctatggcaacagtgatgacatc
ggtgtgttcctcagcaagcggataaaggtcatctccaaaccctccaaaaagaagcagtca
ctgaagaatgccgacttgtgcattgcttcaggaacgaaggtggcgctgttcaatcgcctt
cggtcccagacagttagtaccaggtacctgcatgtagaaggagggaatttccacgccagt
tcacaacagtggggagcattttacatccatctcttggacgacgacgagtcagaaggagag
gagttcacagttagagatggctacatccattacgggcagactgtcaagcttgtgtgctca
gtgactggcatggcactcccaagattgataattaggaaagttgataagcagacggcatta
ctggatgcagacgaccctgtatcacaactccacaaatgtgcgttttaccttaaggataca
gaaagaatgtacttgtgcctttctcaagaaagaataatccaatttcaggccactccatgt
ccaaaagaacaaaataaagaaatgataaacgatggagcttcctggacaatcattagcaca
gataaggcagagtatacgttctatgaggggatgggccccgtccttgccccagtcactcct
gtgcctgtcgtagaaagtcttcagttgaatggcggcggggacgtagcaatgcttgaactt
acaggacaaaactttactccaaatttacgagtgtggtttggggatgtagaagccgaaaca
atgtacagatgtggagagagcatgctctgtgtggtcccagacatttctgcattccgagaa
ggttggagatgggtccggcagccagtccaggttccagtaactttggtccgcaatgacggg
gtcatttactccaccagccttaccttcacctatacaccagagccagggccgaggccacac
tgcagtgctgcaggagcgattctcagagccaactccagccaagtgcccaccaatgagtca
aacacaaacagcgaggggaattacacaaatgccagcacaaattctaccagtgtcacatcg
tccacagcaaccgtggtgtcctaa

KEGG   Mus caroli (Ryukyu mouse): 110311818
Entry
110311818         CDS       T05910                                 

Gene name
Rbpjl
Definition
(RefSeq) recombining binding protein suppressor of hairless-like protein
  KO
K06053  recombining binding protein suppressor of hairless
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04330  Notch signaling pathway
mcal04658  Th1 and Th2 cell differentiation
mcal05017  Spinocerebellar ataxia
mcal05165  Human papillomavirus infection
mcal05169  Epstein-Barr virus infection
mcal05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    110311818 (Rbpjl)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    110311818 (Rbpjl)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110311818 (Rbpjl)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    110311818 (Rbpjl)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    110311818 (Rbpjl)
   05165 Human papillomavirus infection
    110311818 (Rbpjl)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110311818 (Rbpjl)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Other transcription factors
   Others
    110311818 (Rbpjl)
SSDB
Motif
Pfam: BTD LAG1-DNAbind TIG
Other DBs
NCBI-GeneID: 110311818
NCBI-ProteinID: XP_021041032
Ensembl: MGP_CAROLIEiJ_G0024643
UniProt: A0A6P5R7M2
LinkDB
Position
2
AA seq 515 aa
MDPKETTDPSLPPGPLTHLSLPDSSEVRLQSDGPSLLGSWTRSPPEHAIILREGVRTCLQ
QRCEQTVWILHAKVAQKSYGNEKRFFCPPPCVYLAGPGWRVKPMQDQALQSAETGPTVCG
YMGLDGASGSAPETQKLNFEEQPDSREFGCAKTLYISDADKRKHFRLVLRLVLRGGRELG
TFHSRLIKVISKPSQKKQSLKNTDLCISSGSKVSLFNRLRSQTVSTRYLSVEDGAFVASA
RQWAAFTLHLADGHCSQGDFPPREGYIRYGSLVQLVCTVTGITLPPMIIRKVAKQCALLD
VDEPISQLHKCAFQFPGDTPGGAGTYLCLATEKVVRFQASLCPKEANRALLNDSSCWTII
GTESVEFSFSTSLACTREPVTPVPLISTLELSGGGDVATLELHGENFHAGLKVWFGDVEA
ETMYRSPRSLVCVVPDVAAFGSDWRWLRTPITVPVSLLRADALFYPSPFSFTYTPEYSAR
PRLPNAQEPAPDADTLLESIHHEFTRTNFHLFCPT
NT seq 1548 nt   +upstreamnt  +downstreamnt
atggaccccaaggagacaacagacccctcgttgcccccgggccctttgactcacctgagc
ctgccggacagctcagaggtgcggctacagagcgacgggcccagcctcctggggagttgg
accaggtcacccccagagcatgccatcatcctaagggaaggtgtgcgcacatgcctgcag
caaagatgtgagcagactgtgtggatcctgcatgccaaggtggctcagaaatcctatgga
aatgagaagcggttcttctgtcctccaccctgtgtctacctcgcgggtcctggctggagg
gtgaagccaatgcaagaccaagccctccagtctgcggagaccgggcccaccgtctgcggt
tacatgggactggacggtgcgtccggcagcgctcccgagacccagaagttgaactttgaa
gagcagccggactccagggaatttggttgtgccaagaccctgtacatctccgatgctgat
aagaggaagcacttccggctggtgctgagactggtgctgcgagggggccgggagctgggc
actttccacagtcgcctcatcaaagtgatctccaagccctcgcagaagaagcagtcactg
aaaaacacagacctatgcatctcctccggatcaaaggtctcccttttcaatcgcctgcgc
tcccagacagtgtccacgcgttacctctctgtggaagatggggcctttgtggccagcgca
aggcagtgggctgccttcaccctccacctggctgatgggcactgttcccaaggggacttc
ccaccccgggaaggttacatccgctacggctccctggtgcagcttgtctgcactgtcaca
ggcattacactgccgcctatgatcatccgaaaagtggccaagcagtgtgccctccttgat
gtggacgaacccatatcccagctgcacaagtgtgccttccagtttccaggtgacacccca
ggaggggctggcacctacttatgtcttgccacagagaaggtggtgcgattccaggcttcc
ctctgccccaaggaggccaacagggcgctgctcaacgacagctcttgctggaccatcatt
ggcactgagtcggtggagttctccttcagcaccagcctggcctgtactcgggagcccgtc
actccggtgcctctcatcagcactctggagctgagcggtggaggtgatgtggccacgctg
gagctgcacggagaaaatttccacgctgggctcaaggtgtggttcggagacgtggaggca
gaaaccatgtacaggagccctcgttccttggtgtgcgtggtgccagacgtggcggccttc
ggcagcgactggcgttggctccgcacccccatcaccgtgcccgtgagcttgctgcgcgcg
gatgcgctcttctaccccagccccttctccttcacctacaccccggaatacagcgcgcgg
ccgcggctgcccaacgctcaagagcctgcccccgacgcggacacgctcctggagagcatc
caccacgagttcacacgtaccaacttccatctcttctgccccacctag

DBGET integrated database retrieval system