KEGG   Mus caroli (Ryukyu mouse): 110304771
Entry
110304771         CDS       T05910                                 

Gene name
Erbb2
Definition
(RefSeq) receptor tyrosine-protein kinase erbB-2
  KO
K05083  receptor tyrosine-protein kinase erbB-2 [EC:2.7.10.1]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01521  EGFR tyrosine kinase inhibitor resistance
mcal01522  Endocrine resistance
mcal01524  Platinum drug resistance
mcal04010  MAPK signaling pathway
mcal04012  ErbB signaling pathway
mcal04020  Calcium signaling pathway
mcal04066  HIF-1 signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04510  Focal adhesion
mcal04520  Adherens junction
mcal04530  Tight junction
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05206  MicroRNAs in cancer
mcal05212  Pancreatic cancer
mcal05213  Endometrial cancer
mcal05215  Prostate cancer
mcal05219  Bladder cancer
mcal05223  Non-small cell lung cancer
mcal05224  Breast cancer
mcal05226  Gastric cancer
mcal05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110304771 (Erbb2)
   04012 ErbB signaling pathway
    110304771 (Erbb2)
   04066 HIF-1 signaling pathway
    110304771 (Erbb2)
   04020 Calcium signaling pathway
    110304771 (Erbb2)
   04151 PI3K-Akt signaling pathway
    110304771 (Erbb2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110304771 (Erbb2)
   04520 Adherens junction
    110304771 (Erbb2)
   04530 Tight junction
    110304771 (Erbb2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110304771 (Erbb2)
   05206 MicroRNAs in cancer
    110304771 (Erbb2)
   05205 Proteoglycans in cancer
    110304771 (Erbb2)
   05230 Central carbon metabolism in cancer
    110304771 (Erbb2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    110304771 (Erbb2)
   05226 Gastric cancer
    110304771 (Erbb2)
   05219 Bladder cancer
    110304771 (Erbb2)
   05215 Prostate cancer
    110304771 (Erbb2)
   05213 Endometrial cancer
    110304771 (Erbb2)
   05224 Breast cancer
    110304771 (Erbb2)
   05223 Non-small cell lung cancer
    110304771 (Erbb2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110304771 (Erbb2)
   01524 Platinum drug resistance
    110304771 (Erbb2)
   01522 Endocrine resistance
    110304771 (Erbb2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110304771 (Erbb2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110304771 (Erbb2)
   04090 CD molecules [BR:mcal04090]
    110304771 (Erbb2)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     110304771 (Erbb2)
Protein kinases [BR:mcal01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   110304771 (Erbb2)
Exosome [BR:mcal04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   110304771 (Erbb2)
CD molecules [BR:mcal04090]
 Proteins
  110304771 (Erbb2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH DUF5849 Kinase-like EphA2_TM
Other DBs
NCBI-GeneID: 110304771
NCBI-ProteinID: XP_021032017
Ensembl: MGP_CAROLIEiJ_G0017084
UniProt: A0A6P5QFR6
LinkDB
Position
11
AA seq 1258 aa
MELAAWCRWGFLLALLSPGAAGTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNL
ELTYLPANASLSFLQDIQEVQGYMLIAHNRVKHVPLQRLRIVRGTQLFEDKYALAVLDNR
DPLDNVTTAAAAPGRTPEGLRELQLRSLTEILKGGVLIRGNPQLCYQDMVLWKDVLRKNN
QLAPVDMDTNRSRACPPCAPTCKDNHCWGESPEDCQILTGTICTSGCARCKGRLPTDCCH
EQCAAGCTGPKHSDCLACLHFNHSGICELHCPALITYNTDTFESMLNPEGRYTFGASCVT
TCPYNYLSTEVGSCTLVCPPNNQEVTAEDGTQRCEKCSKPCAGVCYGLGMEHLRGARAIT
SDNIQEFAGCKKIFGSLAFLPESFDGNPSSGVAPLKPEHLQVFETLEEITGYLYISAWPE
SLQDLSVFQNLRVIRGRILHDGAYSLTLQGLGIHSLGLRSLRELGSGLALIHRNTHLCFV
NTVPWDQLFRNPHQALLHSGNRPEEACGLEGLVCNSLCAHGHCWGPGPTQCVNCSQFLRG
QECVEECRVWKGLPREYVSGKHCLPCHPECQPQNSSETCFGSEADQCAACAHYKDSSSCV
ARCPSGVKPDLSYMPIWKYPDEEGICQPCPINCTHSCVDLDERGCPAEQRASPVTFIIAT
VVGVLLFLIIVVVIGILIKRRRQKIRKYTMRRLLQETELVEPLTPSGAVPNQAQMRILKE
TELRKLKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGV
GSPYVSRLLGICLTSTVQLVTQLMPYGCLLDHVREHRGRLGSQDLLNWCVQIAKGMSYLE
EVRLVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRR
RFTHQSDVWSYGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVK
CWMIDSECRPRFRELVSEFSRMARDPQRFVVIQNEDLGPSSPMDSTFYRSLLEDDDMGEL
VDAEEYLVPQQGFFSPDPALGTGSTAHRRHRSSSARSGGGELTLGLEPSEEEPPRSPLAP
SEGAGSDVFDGDLAVGVTKGLQSLSPHDLSPLQRYSEDPTLPLPPETDGYVAPLACSPQP
EYVNQPEVRPQSPLTPEGPPPPVRPAGATLERPKTLSPGKNGVVKDVFAFGGAVENPEYL
APRAGTASQPHPSPAFSPAFDNLYYWDQNSSEQGPPPSTFEGTPTAENPEYLGLDVPV
NT seq 3777 nt   +upstreamnt  +downstreamnt
atggagctggcggcctggtgccgttgggggttcctcctcgccctcctgtctcccggagcc
gcgggtacccaagtgtgtaccggcaccgacatgaagttgcggctccctgccagtcctgag
acccacctggacatgctccgccacctctaccagggctgtcaggtggtgcagggcaatttg
gagcttacctacctgcccgccaatgccagcctctcattcctgcaggacatccaggaagtc
cagggatacatgctcatcgctcacaaccgagtgaagcacgtcccactgcagaggttgcgc
atcgtgagagggactcagctctttgaggacaagtacgccctggctgtgctagacaaccga
gaccctttggacaacgtcaccaccgccgccgccgccccaggcagaaccccagaagggctg
cgggagcttcagcttcgaagtctcacagaaatcctgaagggaggagttttgatccgtggg
aaccctcagctctgctaccaggacatggttttgtggaaggatgtcctccgtaagaataac
cagctggctcctgtcgacatggacaccaatcgttcccgggcctgtccaccttgcgcccca
acctgcaaagacaatcactgttggggtgagagtcctgaagactgtcagatcttgactggc
accatctgtaccagtggctgtgcccggtgcaagggccggctgcccactgactgttgccac
gagcagtgtgctgcaggctgcacgggtcccaagcattctgactgcctggcctgcctccac
ttcaatcatagtggtatctgtgagctgcactgcccagccctcatcacctacaacacagac
accttcgagtccatgctcaaccctgagggtcgctacacctttggtgccagctgtgtgacc
acctgcccctacaactacctctccacggaagtgggatcctgcactctggtctgtccccca
aacaaccaagaggtcacagctgaggacggaacacagcggtgtgagaaatgcagcaagccc
tgtgctggagtgtgctatggtctgggcatggagcacctccgaggggcgagggccatcacc
agtgacaatatccaggagtttgctggctgcaagaagatctttgggagcctggcatttttg
ccagagagctttgatgggaacccctcctctggcgttgccccactgaagccagagcatctc
caagtgttcgaaaccctggaggagatcacaggttacctatacatttcagcatggccagag
agcctccaagacctcagtgtcttccagaaccttcgggtcattcggggacggattctccat
gatggtgcttactcattgacgctgcaaggcctggggattcactcgctgggtctacgctca
ctgcgggagctgggcagtggattggctctcattcaccgcaacacccatctctgctttgta
aacactgtaccttgggaccagctcttccgaaacccgcaccaggccctgctccacagtggg
aaccggccagaagaggcatgtggtcttgagggcttggtctgtaactcactgtgtgcccat
gggcactgctgggggccagggcccacccagtgtgtcaactgcagtcagttcctccggggc
caggagtgtgtggaggagtgccgagtatggaaggggctccccagggagtatgtgagtggc
aagcactgtctgccatgccaccccgagtgtcagcctcaaaacagctcggagacctgcttt
ggatcggaggctgaccagtgtgcagcttgtgcccactacaaggactcatcctcctgtgtg
gctcgctgccccagtggtgtgaagccagacctctcctacatgcccatctggaagtacccg
gatgaggagggcatatgtcagccatgccccatcaactgcacccactcctgtgtggacctg
gacgaaagaggctgcccggcagagcagagagccagcccggtgacattcatcattgcaact
gtggtgggcgtcctgttgttcctgatcatagtggtggtcattggaatcctaatcaaacga
aggcgacagaagatccggaagtataccatgcgtaggctgctgcaagagactgagctggtg
gagccgctgacgcccagtggagccgtgcccaaccaggctcagatgcggatcctaaaggag
acggagctaaggaagctgaaggtgctcgggtcaggagccttcggcactgtctacaagggc
atctggatcccagatggggagaacgtgaaaatccccgtggccatcaaggtgttgagggaa
aacacatctcctaaagctaacaaagaaatcctagatgaagcgtacgtcatggctggtgtg
ggttctccgtatgtgtcccgcctcctgggcatctgcctgacatccacagtgcagctggtg
acacagcttatgccctatggctgccttctggaccatgtccgagaacaccgaggtcgctta
ggctcccaggacctgctcaactggtgtgttcagattgccaaggggatgagctacctggag
gaagttcggcttgttcacagggacctagctgcccgaaacgtgctggtcaagagtcccaac
catgtcaagattaccgactttgggctggcacggctgctggacattgatgagactgaatac
catgcagatgggggcaaggtgcccatcaagtggatggcattggaatctattctcagacgc
cggttcacccatcagagtgatgtgtggagctatggtgtgactgtgtgggagctgatgact
tttggggccaaaccttacgatgggatcccagctcgggaaatccctgatttgctggagaag
ggagaacgcctacctcagcctccaatctgcaccattgacgtctacatgatcatggtcaaa
tgttggatgattgactccgaatgtcgcccgagattccgggagttggtatcagaattctcc
cgtatggcgagggacccccagcgctttgtggtcatccagaatgaggacttgggcccctcc
agccccatggacagcaccttctaccgttcactgctggaggatgatgacatgggggagctg
gtcgatgctgaggagtacctggtaccccagcagggattcttctccccagaccctgcccta
ggtactgggagcacagcccaccgcagacaccgcagctcgtcggccaggagtggcggtggt
gagctgacactgggcctggaaccctcggaagaagagccccccagatctccactggctccc
tccgaaggggctggctccgatgtgtttgatggtgacctggcagtgggggtaaccaaagga
ctgcagagcctctctccacatgacctcagccctctacagcggtacagtgaggatcccaca
ttacctctgccccccgagactgatggctacgttgctcccctggcctgcagcccccagccc
gagtatgtgaaccagccggaggttcggcctcagtctcccttgaccccagagggtcctccg
cctcccgtccgacctgctggtgctactctagaaagacccaagactctctctcctgggaag
aatggggttgtcaaagacgtttttgcctttgggggtgctgtggagaaccctgaatactta
gcacccagagcaggcactgcctctcagccccacccttctcctgccttcagcccagccttt
gacaacctctattactgggaccagaactcatcggagcagggtcctccaccaagtaccttt
gaagggacccccactgcagagaaccctgagtacctaggcctggatgtgccagtatga

DBGET integrated database retrieval system