KEGG   Mus caroli (Ryukyu mouse): 110306104
Entry
110306104         CDS       T05910                                 

Definition
(RefSeq) whey acidic protein isoform X1
  KO
K17106  whey acidic protein
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    110306104
SSDB
Motif
Pfam: WAP Dickkopf_N
Other DBs
NCBI-GeneID: 110306104
NCBI-ProteinID: XP_021033948
Ensembl: MGP_CAROLIEiJ_G0016080
UniProt: A0A6P5QRY0
LinkDB
Position
11
AA seq 140 aa
MRCLISLVLGLLALEVALARNLEEQVFNSVQFMSPEASPIEGTECINCQTNEECAQNAMC
CPGSCGRTCKTPVNIGVPKAGFCPWNLLQMITAGPCPKKIECFSDHECSGNMKCCNVDCV
MKCTPPVPEVWSIIIKMEAW
NT seq 423 nt   +upstreamnt  +downstreamnt
atgcgttgcctcatcagcctcgttcttggcctgctggccctggaggtggccctcgctcgg
aacctagaggaacaagtcttcaactcagttcagttcatgtccccagaagccagccccatt
gagggcacagagtgtatcaactgccaaaccaacgaggagtgtgcccagaatgccatgtgc
tgtcccggttcctgtggtaggacctgcaaaactcctgtcaacattggcgttccaaaagct
ggcttctgcccttggaatctactccaaatgatcactgctgggccatgcccaaagaagata
gaatgcttcagcgaccatgagtgttctggcaacatgaaatgctgcaacgtcgactgtgtc
atgaaatgtacacccccagtgccagaggtttggtccatcatcattaagatggaagcttgg
tga

DBGET integrated database retrieval system