KEGG   Mus caroli (Ryukyu mouse): 110306918
Entry
110306918         CDS       T05910                                 

Gene name
Id2
Definition
(RefSeq) DNA-binding protein inhibitor ID-2
  KO
K17693  DNA-binding protein inhibitor ID2
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04350  TGF-beta signaling pathway
mcal04390  Hippo signaling pathway
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    110306918 (Id2)
   04390 Hippo signaling pathway
    110306918 (Id2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110306918 (Id2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    110306918 (Id2)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   HLH domain only
    110306918 (Id2)
SSDB
Motif
Pfam: HLH
Other DBs
NCBI-GeneID: 110306918
NCBI-ProteinID: XP_021034734
Ensembl: MGP_CAROLIEiJ_G0017651
UniProt: A0A6P5QVS2
LinkDB
Position
12
AA seq 134 aa
MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVT
KMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEF
PSELMSNDSKVLCG
NT seq 405 nt   +upstreamnt  +downstreamnt
atgaaagccttcagtccggtgaggtccgttaggaaaaacagcctgtcggaccacagctta
ggtatctcccggagcaaaaccccggtggacgacccgatgagtctgctctacaacatgaac
gactgctactccaagctcaaggaactggtgcccagcatcccccagaacaagaaggtgacc
aagatggaaatcctgcagcacgtcatcgattacatcttggacctgcagatcgccctggac
tcgcatcccactatcgtcagcctgcatcaccagagacctggacagaaccaggcgtccagg
acgccgctgaccaccctgaacacggacatcagcatcctgtccttgcaggcatctgaattc
ccttctgagcttatgtcgaatgatagcaaagtactctgtggctaa

DBGET integrated database retrieval system