KEGG   Mus caroli (Ryukyu mouse): 110308223
Entry
110308223         CDS       T05910                                 

Gene name
Msh3
Definition
(RefSeq) DNA mismatch repair protein Msh3 isoform X1
  KO
K08736  DNA mismatch repair protein MSH3
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01524  Platinum drug resistance
mcal03430  Mismatch repair
mcal05200  Pathways in cancer
mcal05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    110308223 (Msh3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110308223 (Msh3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110308223 (Msh3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110308223 (Msh3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mcal03400]
    110308223 (Msh3)
DNA repair and recombination proteins [BR:mcal03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     110308223 (Msh3)
SSDB
Motif
Pfam: MutS_V MutS_III MutS_II MutS_I MutS_IV NPV_P10
Other DBs
NCBI-GeneID: 110308223
NCBI-ProteinID: XP_021036292
Ensembl: MGP_CAROLIEiJ_G0018767
UniProt: A0A6P5R2X8
LinkDB
Position
13
AA seq 1095 aa
MPRGKSASGGSTAAGPGPGRQTVLSRFFRSAGSLRSSASSTEPAEKVTEGDGRKRSLGNG
GPTKKKAKKVPEKEEENISVASHNPEAKKCLRPRIVLKSLEKLKEFCCDSALPQNRVQTE
ALRERLEVLPRCTDFEDITLQRAKNAVLSEDSKPQANQKDSQFGPCPEIFQKTSDCKPFN
KRSKSIYTPLELQYIDMKQQHKDAVLCVECGYKYRFFGEDAEIAARELNIYCHLDHNFMT
ASIPTHRLFVHVRRLVAKGYKVGVVKQTETAALKAIGDNKSSVFSRKLTALYTKSTLIGE
DVNPLIRLDDSVNIDEVMTDTSTNYLLCIYEEKENIKDKKKGNISVGIVGVQPATGEVVF
DCFQDSASRLELETRISSLQPVELLLPSDLSAPTEMLIQRATNVSVRDDRIRVERMNNAY
FEYSHAFQTVTEFYARDIVDSQGSQSLSGVINLEKPVICALAAIIRYLKEFNLEKMLSKP
ESFKQLSSGMEFMRINGTTLRNLEILQNQTDMKTKGSLLWVLDHTKTSFGRRKLKNWVTQ
PLLKLREINARLDAVSDVLHSESSVFEQIENLLRKLPDVERGLCSIYHKKCSTQEFFLIV
KSLCHLKSELQALMPAVNAHIQSDLLRALIVEVPELLSPVEHYLKVLNEPAAKVGDKTEL
FKDLSDFPLIKKRKNEIQEVIHSIQMHLQEFRKILKLPSLQYVTVSGQEFMIEIKNSAVS
CIPADWVKVGSTKAVSRFHPPFIVESYRRLNQLREQLVLDCSAEWLGFLENFGEHYHTLC
KAVDHLATVDCIFSLAKVAKQGNYCRPTLQEEKKIIIKNGRHPMIDVLLGEQDQFVPNST
SLSQDSERVMIITGPNMGGKSSYIKQVALVTIMAQIGSYVPAEEATIGIVDGIFTRMGAA
DNIYKGRSTFMEELTDTAEIIRRASPQSLVILDELGRGTSTHDGIAIAYATLEYFIRDVK
SLTLFVTHYPPVCELEKCYPEQVGNYHMGFLVNEDESKQDSGDMEQMPDSVTFLYQITRG
IAARSYGLNVAKLADVPREVLQKAAHKSKELEGLVSLRRKRLECFTDLWTTHSVKDLHTW
ADKLEMVEIQTSLPH
NT seq 3288 nt   +upstreamnt  +downstreamnt
atgccccgcgggaaatccgcgtcgggaggctctactgccgccggcccaggcccggggagg
caaacggttctgagccggttcttcagatctgcgggaagcctaagatccagcgcgtcctcc
acggagccagcagagaaggtgacagaaggtgacggcaggaagaggtcactgggaaatggt
gggcccactaagaaaaaagcaaagaaagttccagagaaggaggaagaaaacatctcagta
gcatctcacaaccctgaggcaaagaaatgtctgaggcccaggattgttttaaagtccctg
gaaaagttgaaagaattctgctgtgattctgccctccctcaaaacagagtccagacagaa
gctcttcgggagagacttgaagttctgccaaggtgtactgattttgaagatatcactctg
caacgtgcaaagaatgcggttttgtccgaagattccaaacctcaggctaatcagaaagac
agtcaatttggaccctgccctgaaattttccagaagacttccgattgtaaaccttttaac
aagcgatccaagagcatctatacaccgttagaactgcagtacatagatatgaagcagcag
cataaagacgcagttttgtgcgtggagtgtggttacaagtacagattctttggggaagat
gcagaaattgctgcccgggaactcaatatttattgccacttagaccacaactttatgact
gcaagcatacctacccacagactgttcgtgcatgtccgccgacttgtggccaaaggatac
aaggtgggagttgtgaagcaaactgaaactgccgcattaaaggccatcggagacaataaa
agttctgtcttctcccggaaattgaccgctctttatacgaaatccacacttattggagaa
gatgtgaatcctctcatcaggctggatgattctgtaaatattgatgaggtaatgacagat
acctctaccaactatcttctgtgtatctacgaagaaaaggagaacattaaagacaaaaag
aaggggaacatttccgttggtatcgtgggagtgcagcctgcaaccggcgaagttgtgttt
gactgcttccaggactctgcttccagactggagctggagactcgcatatcaagcctgcag
cctgtggaattactgcttccctccgacctgtctgcgccaacagagatgctcatccaaaga
gccaccaatgtcagtgtgcgggatgacagaattcgagtagaaaggatgaataatgcttac
tttgaatacagccatgctttccagacagttacggagttttatgctagagacatagttgac
agccagggctctcagagtctctctggtgtcattaacttggagaagcctgtgatctgcgcc
ttggctgccataataaggtacctcaaggaatttaacctggaaaagatgctgtccaaaccc
gagagttttaaacagctgtcaagtggaatggaattcatgagaattaatgggacaacgcta
agaaatctggagatcctacagaatcagactgatatgaagaccaaaggaagtttgctttgg
gttttagaccacactaaaacttcatttgggagaaggaagttaaagaattgggttacccag
ccactgcttaaattaagggaaataaatgcccgacttgatgcagtatctgatgttctccac
tcagaatccagtgtgtttgagcagatagaaaaccttcttcgtaagttaccggatgtcgag
agaggactatgtagcatttatcacaagaagtgctctacccaagagttcttcttgatcgtc
aaaagcctgtgtcacctgaagtcagaacttcaagcattaatgcctgctgttaatgcccac
attcagtccgacttactccgagcactcatcgtggaggttcctgagctcctcagcccagtg
gagcattacttaaaggttctgaatgagccagctgccaaagttggcgataaaactgaatta
ttcaaagacctctctgacttccctttaataaaaaagaggaaaaatgaaattcaagaagtc
attcacagcatccaaatgcatttacaggaatttcggaaaatattaaaacttccttcttta
caatatgtgactgtatcaggacaagagtttatgattgaaataaagaactcagctgtatct
tgcatcccagctgattgggtgaaggttggaagcacaaaagctgtgagccgctttcaccct
cccttcattgtggaaagctacagacgtctgaatcagctccgggagcagctagtccttgac
tgcagtgctgaatggcttggcttcctagagaattttggtgaacattatcacactttgtgt
aaggctgtggatcacctagcaactgttgactgtattttctccctggccaaggtcgctaaa
caaggaaattactgcaggccaactctacaagaagaaaagaaaatcatcataaaaaatgga
aggcaccctatgattgatgtgttgctgggtgaacaagatcagtttgtgcccaacagtacg
agtttatcacaggactctgagagagtcatgataatcaccggaccaaacatgggtgggaag
agctcctacataaaacaggttgccctggttaccatcatggctcagattggctcctacgtt
cctgcagaggaagccacaatcgggattgtggatggcattttcacaaggatgggtgctgca
gacaatatctacaaaggccggagtactttcatggaagaactgacggacacagcggaaata
atcaggagagcgtccccacagtccttggttatcctggatgagctggggagagggacaagc
acccatgacggaatcgccatcgcctatgcaactctagagtattttatccgagacgtgaaa
tctttaacactgttcgttacccactatccaccggtctgtgaactagaaaaatgttaccca
gagcaagtggggaattaccacatgggattcttggtcaatgaggatgaaagcaagcaggac
tcgggtgacatggagcagatgccggattctgtcacttttctctatcagataacccgagga
attgcagcgagaagttatggactgaatgtggcgaagctagcagacgtgcctagagaagtc
ttacagaaagctgcgcacaagtctaaggagctggaaggcttagtcagtctgagaaggaaa
aggcttgaatgctttaccgacttatggacgacacacagtgtgaaggacctgcacacatgg
gcagataagctggaaatggtggaaatacagacttctctcccacattag

DBGET integrated database retrieval system