KEGG   Mus caroli (Ryukyu mouse): 110309132
Entry
110309132         CDS       T05910                                 

Gene name
Rapgef1
Definition
(RefSeq) rap guanine nucleotide exchange factor 1 isoform X1
  KO
K06277  Rap guanine nucleotide exchange factor 1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04015  Rap1 signaling pathway
mcal04510  Focal adhesion
mcal04722  Neurotrophin signaling pathway
mcal04910  Insulin signaling pathway
mcal05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110309132 (Rapgef1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110309132 (Rapgef1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    110309132 (Rapgef1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110309132 (Rapgef1)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    110309132 (Rapgef1)
SSDB
Motif
Pfam: RasGEF RasGEF_N
Other DBs
NCBI-GeneID: 110309132
NCBI-ProteinID: XP_021037225
Ensembl: MGP_CAROLIEiJ_G0023367
UniProt: A0A6P5QYZ4
LinkDB
Position
2
AA seq 1223 aa
MSSGLGLRRSPEMSGKIEKADSQRSHLSSFTMKLMDKFHSPKIKRTPSKKGKPAEVSKIP
EKPVSKEARDRFLPEGYPIPLDLEQQAVEFMSTSAVASRSQRQKNLCWLEEKEKEVVSAL
RYFKTIVDKMAIDKKVLEMLPGSASKVLEAILPLVQTDPRIQHSSALSSCYSRVYQSLAN
LIRWSDQVMLEGVNSEDKEMVTTVKGVIKAVLDGVKELVRLTIEKQGRPSPTSPVKPSSP
ASKPDGQPELPLTDREMEILNKTSVSPSAELLPDSTSEEVAPPKPPLPGIRVVDNSPPAL
PPKKRQSAPSPTRVAVVAPMSRATSGSSLPVGINRQDFDVECYTQRRLSGGSRSCGGESP
RLSPCSSTGKLSRSDEQLSSLDRDSGQCSRNTSCETLDHYDPDYEFLQQDLSNADQTPPQ
AACSLSPLPESLGESGPPFLGHPFQLPLGSCLQQEGQQTDTPPALPEKKRRSAVSQTTDS
SGCRVSYERHPSQYDNISEGDLQNPVPVQPVPYPPFAAVLPFQQGASSASAEFVGDFSVP
ELAGDTEKPPPLPEKKNKHMLAYMQLLEDYSEPQPSMFYQTPQSEHIYQQKNKMLMEVYG
FSDSFCGSDSTQELAPPPALPPKQRQLQASYAASSFSVSYCVQQTKVAFTPEDGSAAQGL
SVSVSNSFLNRHGSLPVPSYKSVFRSYSQDFMPHHQASVQPFLPPTSSSSPHFPPVHTSQ
SSDLAVPTVSSPPPSTVDGPLSSSQDSSFHGNPVRLPSETSFTDSEPPSGKDGHPRDPSV
SSASGKDSRENGERSPKSLDGLESAQSEEEVDELSLIDHNEIMARLTLKQEGDDGPDVRG
GSGDILLVHATETDRKDLVLYCEAFLTTYRTFISPEELIKKLQYRYEKFSPFADTFKKRV
SKNTFFVLVRVVDELCLVELTEEILKLLMELVFRLVCSGELSLARVLRKNILDKVDQKKL
LRCAHSDQPLAARGVAARPGTLHDFHSHEIAEQLTLLDAELFYKIEIPEVLLWAKEQNEE
KSPNLTQFTEHFNNMSYWVRSIIMLQEKAQDRERLLLKFIKIMKHLRKLNNFNSYLAILS
ALDSAPIRRLEWQRQTSEGLAEYCTLIDSSSSFRAYRAALSEVEPPCIPYLGLILQDLTF
VHLGNPDYIDGKVNFSKRWQQFNILDSMRCFQQAHYEIRRNDDIINFFNDFSDHLAEEAL
WELSLKIKPRNITRRKTDREEKT
NT seq 3672 nt   +upstreamnt  +downstreamnt
atgagcagcggcctcggcctccggcgcagcccggaaatgtccggcaagatcgagaaagca
gactctcagcgttctcatctctcctccttcaccatgaagctgatggacaaattccactct
cccaaaatcaagagaacaccatccaagaagggaaagccagccgaggtgtcgaagattcct
gagaagcctgtgagcaaagaggcaagagacagatttctaccagagggctaccctatcccc
ttggatctggagcagcaggcagtagaatttatgtccaccagtgctgtggcttccaggtct
cagaggcagaagaacctgtgctggctggaggagaaagagaaggaggttgtcagtgccttg
cgctactttaagaccattgtggacaaaatggccattgataagaaggttctggagatgctc
ccggggtcggccagcaaggtgctggaggccatcttacccctggtgcagactgaccctcgg
atccagcacagctcagccctctcctcctgttatagccgagtataccagagcctcgccaac
cttatccgatggtctgaccaggtgatgctagagggcgtgaactcagaagataaggagatg
gtgacaactgtgaagggcgttatcaaagctgtcctggacggagtgaaggagctagtgagg
ctaaccattgagaagcaggggcggccatcgccaacaagcccagtgaagcccagttcccca
gccagcaagcctgatggccagcctgagctccctctgacagaccgagaaatggagattctg
aataagacaagtgtgtcaccatctgctgaactgctcccagactccaccagtgaagaggtt
gcaccccccaagccccctttacctggcatccgggtggttgataacagtccaccagcatta
ccacccaagaaaaggcagtctgctccatcccccacccgggtggctgtggtagccccaatg
agtcgggctaccagtggctccagtttgcctgttggaatcaataggcaggactttgatgtt
gaatgttacacccagaggcgcctgtcaggaggcagccgctcctgcggtggtgagtctcct
cgcctgtccccctgcagcagcacgggcaagctcagccgctcagacgagcagctgtcctcc
ctggacagggatagtgggcagtgctcacggaacacaagctgtgaaacgctagatcactac
gaccccgactatgaattcctccagcaagatctctccaatgcagaccagacccctccacag
gcagcctgtagcctcagccctctgccagagtccctgggggaatctgggcctccgtttctt
ggccaccctttccagctgcctttgggcagctgtctccagcaggagggacagcagacagac
actccacctgcccttcctgagaagaagcgtaggagcgcagtctcccagaccacggacagc
tctggctgcagggtgtcctatgagcgacacccctcacagtatgacaacatctcagagggt
gacctgcagaacccagtcccagtccagcctgtgccctacccaccctttgctgctgtcctg
ccctttcagcagggggcttcgtctgcctctgctgagtttgtgggtgatttcagtgttcct
gagttggcaggtgacacagagaagccacctcctctaccagagaagaagaacaagcacatg
ctggcctacatgcaactgctggaggactactcagagccacagccctccatgttctaccag
acaccgcagagtgagcacatctaccagcagaagaacaagatgctcatggaggtgtacggc
ttcagcgactccttctgcggtagtgattccacgcaggagctggcccctccaccggctctg
ccccccaagcaacggcagctgcaggcctcctatgctgcttcttccttctctgtctcctac
tgtgtccagcaaactaaagtggccttcacccccgaggacggcagtgccgctcagggcctc
agtgtatccgtgtctaactcctttctcaaccggcacggcagcttgcctgtgccctcgtac
aaatctgtgtttaggtcttattcccaggacttcatgcctcaccaccaagcctccgtccaa
cctttccttccgcctacctcctcttcctctccacatttcccacctgtccacacgtcccag
agctcggacttagcggtgcccaccgtaagcagtccgcctcccagcaccgtggacgggcct
ctctcgtcttctcaggacagcagctttcatgggaaccctgtccgccttccttccgaaacc
tctttcactgactcggaaccaccatctgggaaggacggacatcccagagatccttcggtc
agcagtgcatctgggaaggacagcagagaaaatggagaaaggtccccaaagtcactggat
ggtctggagtcagcgcagtcagaagaggaagtggatgaactgtccctcattgaccacaat
gaaatcatggccaggctgacactcaagcaagagggtgatgatgggccagatgttcgtggt
ggttcaggagacatcttactggtccatgctactgagacagacagaaaagacctggtgctg
tactgtgaagccttcctgaccacctacaggaccttcatcagcccggaggagctcatcaag
aagctgcagtaccggtacgagaagttctctccctttgctgacacgttcaagaagcgagtg
agcaagaacacattctttgtgctggtgcgagtggtggatgagctctgcctggtggagctg
acagaggagatcctgaagctgctgatggagctggtcttccgcctagtgtgcagcggagag
ctcagcctggccagagtcctccggaagaacattctggacaaggtggaccagaagaagctg
ctcaggtgtgcccattccgaccagcctctggcagccaggggtgttgcagccaggccagga
accttgcatgatttccacagccatgagatagccgagcagctgacactgctggatgccgag
cttttctacaagatagagattcctgaagttttgctttgggccaaagagcagaatgaggag
aagagtcccaatctgacccagttcacagagcacttcaacaacatgtcctactgggtgcgg
tccatcatcatgctgcaggagaaggcccaggaccgagagaggctgctcctcaagttcatc
aagatcatgaagcacctgcgcaagctcaacaacttcaactcctacttggccatcctctca
gcactagactcggcccccatccgcagactggagtggcagcggcagacctcagagggcctg
gctgaatactgcacattgattgacagctcatcctccttccgagcctaccgggctgctctc
tcagaggtggagcccccatgtatcccgtacctaggtctgattcttcaagacctgaccttc
gttcacctgggaaacccagattatattgacgggaaagtaaacttctccaagcggtggcaa
cagttcaacatcttggacagcatgcggtgcttccagcaggcgcactatgaaatccggaga
aacgacgacatcataaatttcttcaatgacttcagtgaccacctggccgaggaagccctg
tgggaactctctctgaagatcaagcctaggaacataacaaggcgaaaaacagaccgcgaa
gagaagacctag

DBGET integrated database retrieval system