KEGG   Mus caroli (Ryukyu mouse): 110311366
Entry
110311366         CDS       T05910                                 

Gene name
Etv5
Definition
(RefSeq) ETS translocation variant 5
  KO
K15593  ets translocation variant 5
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal05202  Transcriptional misregulation in cancer
mcal05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    110311366 (Etv5)
  09162 Cancer: specific types
   05215 Prostate cancer
    110311366 (Etv5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110311366 (Etv5)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    110311366 (Etv5)
SSDB
Motif
Pfam: ETS_PEA3_N Ets HSF_DNA-bind
Other DBs
NCBI-GeneID: 110311366
NCBI-ProteinID: XP_021040270
Ensembl: MGP_CAROLIEiJ_G0020603
UniProt: A0A6P5R5V2
LinkDB
Position
16
AA seq 510 aa
MDGFCDQQVPFMVPGKSRSEDCRGRPLIDRKRKFVDTDLAHDSEELFQDLSQLQEAWLAE
AQVPDDEQFVPDFQSDNLVLHAPPPTKIKRELHSPSSELSSCSHEQALGAKYGEKCLYNY
CAYDRKPPSGFKPLTPPATPLSPTHQNSLFPPPQATLPTSGLTPGAGPVQGVGPAPTPHS
LPEPGSQQQTFAVPRPPHQPLQMPKMMPESQYPSEQRFQRQLSEPSHPFPPQSGVPGDSR
PSYHRQMSEPIVPAAPPPLQGFKQEYHDPLYEHGVPGMPGPPAHGFQSPMGIKQEPRDYC
ADSEVPNCQSSYMRGGYFSSSHEGFPYEKDPRLYFDDTCVVPERLEGKVKQEPTMYREGP
PYQRRGSLQLWQFLVTLLDDPANAHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYD
KLSRSLRYYYEKGIMQKVAGERYVYKFVCDPDALFSMAFPDNQRPFLKAESECPLNEEDT
LPLTHFEDNPAYLLDMDRCSSLPYAEGFAY
NT seq 1533 nt   +upstreamnt  +downstreamnt
atggatgggttttgtgatcagcaagtcccttttatggtcccggggaaatctcgatcagag
gactgtcgggggcgacctttgattgacagaaagaggaagtttgtggacacagatctggct
cacgattctgaagagttgtttcaggatcttagccaactgcaggaggcttggctagctgaa
gcacaagttcccgatgatgagcagtttgtcccagattttcagtctgacaacttggtgctt
catgctccacctcccaccaagatcaaacgggagctgcacagcccctcctccgagttgtcg
tcctgtagccacgagcaggctcttggtgctaagtatggagaaaagtgcctctacaactat
tgtgcctacgataggaagcctccctctgggttcaagccattaaccccgcccgccactcct
ctgtcacccacccatcagaattccctatttcccccacctcaggcaactctgcccacctca
ggtctcacccctggagctggcccagttcaaggggtgggtcctgccccgactcctcactca
cttccagaacctggatcacagcaacaaacatttgcggtcccccggccaccacatcagccc
ctgcaaatgccaaagatgatgcctgaaagccagtatccatcagaacagagatttcagcga
cagctgtctgagcccagccatcccttccctcctcagtcaggagttcctggagatagtcgc
cccagctaccaccggcagatgtcagagcccattgtccccgcagctccgccaccccttcag
ggattcaagcaggaataccatgacccactgtatgaacacggggtccctgggatgcctggt
cctccagcacatggattccagtcacccatgggaatcaagcaggagccccgagattactgt
gctgactcagaagtgcctaactgccagtcatcctacatgagaggcgggtatttctccagc
agccatgaaggattcccgtatgaaaaggaccccaggctgtactttgatgatacttgcgtg
gtgcctgagagactggaaggcaaagtcaagcaggagcccaccatgtatcgagaggggccc
ccttatcagagacgaggctctctgcagctgtggcagttcctcgtcaccctcctggatgac
ccagccaatgcccacttcattgcctggactggccgaggcatggaatttaagctcatagaa
ccggaagaggttgctcgtcgttggggtatccagaagaatcggccagccatgaactatgac
aagctgagccgctctctccgctattactatgaaaagggcatcatgcagaaggtggctggg
gaacgctacgtctacaaatttgtgtgtgacccggatgcacttttctctatggccttcccg
gacaatcagcgcccgttcctgaaggcagaatccgaatgccccctcaatgaggaggacacg
ctgcctctgactcactttgaagacaaccctgcttacctcctggacatggatcgctgcagc
agcctcccctacgccgaaggcttcgcttactaa

DBGET integrated database retrieval system