KEGG   Macaca mulatta (rhesus monkey): 699582
Entry
699582            CDS       T01028                                 

Gene name
CD3D
Definition
(RefSeq) T-cell surface glycoprotein CD3 delta chain isoform X1
  KO
K06450  T-cell surface glycoprotein CD3 delta chain
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04640  Hematopoietic cell lineage
mcc04658  Th1 and Th2 cell differentiation
mcc04659  Th17 cell differentiation
mcc04660  T cell receptor signaling pathway
mcc05142  Chagas disease
mcc05162  Measles
mcc05166  Human T-cell leukemia virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcc05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    699582 (CD3D)
   04660 T cell receptor signaling pathway
    699582 (CD3D)
   04658 Th1 and Th2 cell differentiation
    699582 (CD3D)
   04659 Th17 cell differentiation
    699582 (CD3D)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    699582 (CD3D)
  09163 Immune disease
   05340 Primary immunodeficiency
    699582 (CD3D)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    699582 (CD3D)
   05170 Human immunodeficiency virus 1 infection
    699582 (CD3D)
   05162 Measles
    699582 (CD3D)
   05169 Epstein-Barr virus infection
    699582 (CD3D)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    699582 (CD3D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcc04090]
    699582 (CD3D)
CD molecules [BR:mcc04090]
 Proteins
  699582 (CD3D)
SSDB
Motif
Pfam: Ig_4 ITAM Ig_5 DAP10
Other DBs
NCBI-GeneID: 699582
NCBI-ProteinID: XP_014971303
Ensembl: ENSMMUG00000048164
LinkDB
Position
14
AA seq 176 aa
MEHSTFLSGLVLATLLSQGKATPVSPFKIPVEELEDRVFVKCNTSVTWVEGTVGTLLTNN
TRLDLGKRILDPRGIYRCNGTDIYKDKESAVQVHYRMCQNCVELDPATLAGIIVTDVIAT
LLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSRLGGNWARNK
NT seq 531 nt   +upstreamnt  +downstreamnt
atggaacatagcacgtttctgtctggactggtactggctacccttctctcccaaggtaaa
gctactccagtgagccccttcaagatacctgtagaggaacttgaggacagagtgtttgtg
aaatgcaataccagcgtcacatgggtagagggaacggtgggaacactgctcacaaataat
acaagactggacctgggaaaacgcatcctggacccacgaggaatatataggtgtaatggg
acagatatatacaaggacaaagaatctgctgtgcaagttcattatcgaatgtgccagaac
tgtgtggagctggatccagccaccctggctggcatcattgtcactgatgtcattgccact
ctgctccttgctttgggagtcttctgctttgctggacatgagactggaaggctctctggg
gctgccgacacacaagctctattgaggaatgaccaggtctatcagcccctccgagatcga
gatgatgctcagtacagccgccttggaggaaactgggctcggaacaagtga

DBGET integrated database retrieval system