KEGG   Macaca mulatta (rhesus monkey): 701024
Entry
701024            CDS       T01028                                 

Gene name
AOX1
Definition
(RefSeq) aldehyde oxidase
  KO
K00157  aldehyde oxidase [EC:1.2.3.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00280  Valine, leucine and isoleucine degradation
mcc00350  Tyrosine metabolism
mcc00380  Tryptophan metabolism
mcc00750  Vitamin B6 metabolism
mcc00760  Nicotinate and nicotinamide metabolism
mcc00830  Retinol metabolism
mcc00982  Drug metabolism - cytochrome P450
mcc01100  Metabolic pathways
mcc04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    701024 (AOX1)
   00350 Tyrosine metabolism
    701024 (AOX1)
   00380 Tryptophan metabolism
    701024 (AOX1)
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    701024 (AOX1)
   00760 Nicotinate and nicotinamide metabolism
    701024 (AOX1)
   00830 Retinol metabolism
    701024 (AOX1)
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    701024 (AOX1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    701024 (AOX1)
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     701024 (AOX1)
SSDB
Motif
Pfam: Ald_Xan_dh_C2 FAD_binding_5 Ald_Xan_dh_C Fer2_2 CO_deh_flav_C Fer2
Other DBs
NCBI-GeneID: 701024
NCBI-ProteinID: NP_001268238
Ensembl: ENSMMUG00000021931
UniProt: M1ZMN0
LinkDB
Position
12
AA seq 1338 aa
MDRASELLFYVNGRKVIEKNVDPETMLLPYLRKKLRLTGTKYGCGGGGCGACTVMISRYN
PITNRIRHHPANACLIPICSLYGTAVTTVEGIGSTHTRIHPVQERIAKCHGTQCGFCTPG
MVMSIYTLLRNHPEPTLHQLTDALGGNLCRCTGYRPIIDACKTFCETLGCCQSKENGVCC
LDQGINGLPEFEEGSKTSPKLFAEEEFLPLDPTQELIFPPELMIMAEKQPQRTRVFGSER
MMWFSPVTLKELLEFKFKYPQAPVIMGNTSVGPQVKFKGVFHPVIISPDRIEELSVVNHT
HNGLTLGAGLSLAQVKDILADVVQKLPEEKTQTYHALLKHLGTLAGSQIRNMASLGGHII
SRHPDSDLNPILAVGNCTLNLLSKEGKRQIPLNEQFLSKCPNADLKPQEILVSVNIPYSR
KLEFVSAFRQAQRQENALAIVNSGMRVFFGEGHGIIRELSISYGGVGPATICAKNSCQKL
IGRHWNEEMLDTACRLVLEEVSLSGSAPGGKVEFKRTLIISFLFKFYLEVSQILKKMDPI
HYPSLADKYESALEDLHSKHHCSTLKYQHMGPKQHPEDPIGHPIMHLSGVKHATGEAIYC
DDMPPVDQELFLTFVTSSRAHAKIVSIDLSEALSMPGVVDVITAEHLSDVNSFCFFTEAE
EFLATDKVFCVGQLVCAVLADSEVQAKQAAKQVKIVYQDLEPLILTIKEAIQHNSFFEPE
RKLEYGNVDEAFKVVDQILEGEIHMGGQEHFYMETQSMLVVPKGEDQEMDVYVSTQFPKY
IQDIVASTLKLPANKVMCHVKRVGGAFGGKAFKTGVIAAVTAFAANKHGRAVRCVLERGE
DMLITGGRHPYLGKYKAGFMNDGRILALDMEHYSNAGNSLDESLLVIEMGLLKMDNAYKF
PNLRCRGWACRTNLPSNTAFRGFGFPQAGLITESCIMEVAAKCGLSPEKVRMINMYKEID
QTPYKQEINAKNLIQCWRECMAVSSYSLRKAAVEKFNAENYWKKKGLAMVPLKYPVGLGS
RAAGQAAALVHIYLDGSVLVTHGGIEMGQGVHTKMIQVVSRELGMPISNVHLRGTSTETV
PNANVSGGSVVADLNGLAVKDACQTLLKRLEPIISKNPKGTWKDWAQTAFDDSISLSAVG
YFRGYESDINWEKGEGHPFEYFVYGAACSEVEIDCLTGDHKNIRTDIVMDVGCSINPAID
IGQIEGAFIQGMGLYTIEELNYSPQGVLHTRGPDQYKIPAICDTPTEFHISLLPPSENSN
TLYSSKGLGESGVFLGCSVFFAIHDAVSAARRERGLHGPLSLNSPLTPEKIRMACEDKFT
KMIPRDEPGSCVPWNVPI
NT seq 4017 nt   +upstreamnt  +downstreamnt
atggacagggcgtccgaactgctcttctacgtgaacggccgcaaggtgatagaaaaaaat
gttgatcctgaaacaatgctgttgccttatctgaggaagaagcttcgactcacgggaact
aagtatggctgtggaggaggaggctgtggtgcttgtacagtgatgatatcacgatataac
cccatcaccaacaggataaggcatcacccagccaatgcctgtctgattcccatctgttct
ctgtatggtactgccgtcaccacagtagaaggcataggaagcacccacaccagaattcat
cctgttcaggagaggatcgccaagtgtcacggaacccagtgtggcttctgcacacccggg
atggtgatgtccatctacacgctgctcaggaaccacccggagcccactctgcatcagtta
actgatgcccttggtggtaacctgtgccgttgcactggatacaggcccataattgatgca
tgcaagactttctgtgaaactttgggctgctgtcaaagtaaagaaaatggggtttgctgt
ttggatcaaggaatcaatggattgccagaattcgaggaaggaagtaagacaagtccaaaa
ctcttcgcagaagaggagtttctgccattggatccaacccaggaactgatatttcctcct
gagctaatgataatggctgagaaacagccgcaaaggaccagggtgtttggcagtgagaga
atgatgtggttttcccccgtgaccctgaaggaactgctggaatttaaattcaagtatccc
caggcccctgtcatcatgggaaacacctctgtggggcctcaagtgaaatttaaaggcgtc
tttcacccagttataatttctcctgatagaattgaagaactgagtgttgtaaaccataca
cataatggactcacccttggtgctggtctcagcctagcccaggtgaaggacattttggct
gacgtagtccagaagcttccagaggagaagacacagacataccatgctctcctgaagcat
ttgggaactctggctgggtcccagatcaggaacatggcttctttagggggacacatcatt
agcaggcatccagattcagatctgaatcccatcctggctgtgggtaactgtaccctcaac
ttgctatcaaaagaaggaaaacgacagattcctttaaacgagcagttcctcagcaagtgc
cctaatgcagatcttaagcctcaagaaatcttggtctcagtgaacatcccctactcaagg
aagttggaatttgtgtcagccttccgacaagcccagcgacaggagaatgcactagcgata
gtcaattcaggaatgagagtcttttttggagaagggcatggcattattagagagttatcc
atctcatatggaggcgttggtccagccaccatctgtgccaagaattcctgccagaaactc
attggaaggcactggaatgaagaaatgctggatacagcttgcaggcttgttctggaggaa
gtctccctttcgggctcggcgccaggtggaaaggtggagttcaagaggactctcatcatc
agcttcctcttcaagttctacctggaagtgtcacagattttgaaaaagatggacccaatt
cactatcctagccttgcagacaagtatgaaagtgctttagaagatcttcattccaaacat
cactgcagtacattaaagtaccagcatatgggcccaaagcagcatcctgaagacccaatt
ggccaccccatcatgcatctgtctggtgtgaagcacgccacaggggaggccatctactgt
gatgacatgcctccggtggaccaggaacttttcttgacctttgtgactagttcaagagct
catgctaagattgtgtctattgatctgtcagaagctctcagcatgcccggtgtggtggac
gtcataacagcagaacatcttagtgatgtcaactccttctgctttttcaccgaagctgag
gaatttctggcgacagataaggtgttctgtgtgggtcagcttgtctgtgccgtgcttgct
gattctgaggttcaggcaaagcaagctgctaagcaagtgaagattgtctatcaagatttg
gagccactgatcctaacaatcaaggaagctatacaacacaactccttcttcgagccagaa
aggaaactggaatatggaaatgttgatgaagcatttaaagtggttgatcaaattcttgaa
ggtgaaatacatatgggaggtcaagaacatttttatatggaaacccaaagcatgcttgtt
gttcccaagggagaggatcaagaaatggatgtctacgtgtctacacagtttcctaaatat
atacaggacattgttgcctccaccttgaagctcccagctaacaaggtcatgtgccatgta
aagcgtgttggtggagcatttggagggaaggcgttcaaaaccggagtcattgcagccgtc
actgcatttgccgcaaacaaacatggccgtgcagttcgctgtgttctggaacgaggagaa
gacatgttaataactggaggccgccatccttaccttggaaagtacaaagctggattcatg
aatgatggcagaatcttggccctggacatggagcattatagcaatgcaggcaactctttg
gatgaatcattattggtgatagaaatgggacttctgaaaatggacaatgcttacaagttt
cccaacctccgctgccggggttgggcatgcagaaccaaccttccatccaacacggctttt
cgtgggtttggctttcctcaggcagggctgatcaccgaatcttgtatcatggaagttgca
gccaaatgtggactgtcccctgagaaggtgcgaatgataaacatgtacaaggaaattgat
caaacaccctacaaacaagagatcaatgccaagaacctgatccagtgttggagagaatgt
atggccgtgtcttcctactccttgaggaaagcggctgtggaaaaattcaacgcggagaat
tactggaagaagaaaggactggccatggtccccctgaagtatcctgttggccttggctca
cgcgctgctggtcaggctgctgccttggttcacatttatcttgacggctctgtgctggtc
actcacggtggaattgaaatggggcagggggtccacactaaaatgattcaggtggtcagc
cgtgaattaggaatgccaatttcgaatgtccacctgcgtggaacaagcacagaaaccgtc
cctaatgcaaatgtctctggaggttctgtggtggcagatctcaacgggttggcagtaaag
gatgcctgtcaaactcttctaaaacgcctcgaacccatcatcagcaagaatcctaaagga
acttggaaagactgggcacagactgcttttgatgacagcattagcctttcagctgttgga
tacttcagaggttatgagtcagacataaactgggagaaaggcgaaggccatcccttcgaa
tacttcgtttatggagctgcctgttccgaggttgaaatagactgcctgacgggggatcat
aagaacatcagaacagacattgtcatggatgttggctgcagtataaatccagccattgac
ataggccagattgaaggtgcatttattcaaggcatgggactttatacaatagaagaactg
aattattctccccagggcgttctgcacactcgtggtccagaccaatataaaatccctgcc
atctgtgacacacccacagagtttcacatttctttgttgcctccctctgaaaactcaaat
actctttattcgtctaagggtctgggagagtcgggggtgttcctggggtgttccgtgttt
ttcgctatccatgatgcagtgagtgcagcacgacgggagagaggcctgcacggacccttg
agccttaatagtccgctgaccccggagaagattaggatggcctgtgaagacaagttcaca
aaaatgattccgagagatgagcctgggtcctgtgttccttggaatgtacccatctga

KEGG   Macaca mulatta (rhesus monkey): 701502
Entry
701502            CDS       T01028                                 

Gene name
AOX4
Definition
(RefSeq) aldehyde oxidase 4
  KO
K00157  aldehyde oxidase [EC:1.2.3.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00280  Valine, leucine and isoleucine degradation
mcc00350  Tyrosine metabolism
mcc00380  Tryptophan metabolism
mcc00750  Vitamin B6 metabolism
mcc00760  Nicotinate and nicotinamide metabolism
mcc00830  Retinol metabolism
mcc00982  Drug metabolism - cytochrome P450
mcc01100  Metabolic pathways
mcc04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    701502 (AOX4)
   00350 Tyrosine metabolism
    701502 (AOX4)
   00380 Tryptophan metabolism
    701502 (AOX4)
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    701502 (AOX4)
   00760 Nicotinate and nicotinamide metabolism
    701502 (AOX4)
   00830 Retinol metabolism
    701502 (AOX4)
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    701502 (AOX4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    701502 (AOX4)
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     701502 (AOX4)
SSDB
Motif
Pfam: Ald_Xan_dh_C2 FAD_binding_5 Ald_Xan_dh_C Fer2_2 CO_deh_flav_C Fer2
Other DBs
NCBI-GeneID: 701502
NCBI-ProteinID: NP_001305103
Ensembl: ENSMMUG00000047974
UniProt: M1ZMN2
LinkDB
Position
12
AA seq 1332 aa
MPSLPHSDELIFFVNGRKVIERNADPEVNLLFYVRKRLRLTGTKYSCGGGGCGACTVMVS
RYNSTTKAIHHYPATVCLVPICSLYGAAVTTVEGVGSIKTRIHPVQERLAKCHGTQCGFC
SPGMVMSIYTLLRNHPEPAPEQITKALGGNLCHCTGYQPIVESGKTFCESTVCELKGSGK
CCMDQEDGSLVNRWEKMCTKLYDEDEFQPLDPSQEPIFPPELIRMAEDPNKRRLTFQGER
TTWITPATLNDLLELKANFPKAPLVMGNTELGPRIKFKNEFHPVFISPLGLPELHFVNTT
DDGVTIGAGYSLAQLNDTLHFIVSEQPKEKTKTYRALLKHLRTLAGAQIRNMATLGGHVV
SRPNFSDLNPILAAGNAAINLISKGQRQIPLNGPFLERSPEADLKSEEIVSSVYIPYSTQ
WHFVFGLRMAQRQENAFAIVNAGMSVKFEDGTNTIKNFKCSMKRGPHHCLCKPNCKQLIG
RQWDDQMLSDACRWVLDEIYIPPAAEGGMVEYRRTLIISLLFKFYLKVRRGLNQMDPQKF
PDIPEKFMSALEDFPIETPQGIQMFQCVDPHQPPQDPVGHPVMHQSAIKHTTGEAVYIDD
MPCIDQELFLAPITSTRAHAKIISIDISEALALPGVVDVITAEDVPGDNNYQGEIFYAQN
EIICVGQIVGTVAADTYAHAREAAKKVKIAYEDIEPRIITIEQALKHNSFLFDEKKIEQG
NVEQAFKYVDQIIEGEVHVEGQEHFYMETSSILALPKEEDKEMVLHLGTQYPTRVQEYVA
AALNVPRNRITCRMKRTGGAFGGKVAKPAVLGAVSAVAANKTGRPIRFILERGDDMLITA
GRHPLLGKYKIGFMNNGVIKPADVEYYVNGGCTPDESEMVVEFIVLKSENAYYIPNFRCR
GRACKTNLPSNTAFRGFGFPQGTVVVEAYITAVASQCNLPPEEVKEINMYKRISKTAFKQ
TFNPEPLRRCWKECLEKSSFYTRKLAAEEFNKKNYWKKRGLAIVPMKFCIGIPTAYYNQA
AALVHIYLDGSVLVTHGGCELGQGLYTKMIQGASHELNIPQSYIHLSETSTVTVPNGVFT
SGSMGTDINGKAVQNACQALMARLHPIIRKNPKGKWEDWIAKAFEKSISLSATGYFKGYQ
TNMDWEKGEGNAYPYYVYGAACSEVEVDCLTGAHKLLRTDIFMDAAFSINPALDIGQVEG
AFIQGMGFYTIEELKYSPEGVLYSRSPDDYKIPTVTEIPEEFYVTLVRSQNPIAIYSSKG
LGEAGMFLGSSVLFAIYDAVAAARRERGLAKTFVLSSPATPEMIRMTCVDQFTDMIPRDD
PSTFTPWSIRVS
NT seq 3999 nt   +upstreamnt  +downstreamnt
atgccttcccttccccattctgatgagctgatttttttcgtgaacggaaggaaggtgata
gagaggaatgctgatcctgaagtaaatctactgttctacgtgaggaaaagacttcgtctt
acaggcactaaatattcctgtggaggaggaggctgcggtgcctgtacagtaatggtgtca
agatacaactccacgaccaaggcgatccaccattatccagcaacggtgtgcctggtaccc
atctgttctctgtatggggctgcagtcaccaccgtggaaggtgtgggaagcatcaaaacc
aggattcaccctgtgcaggaaagacttgccaagtgtcatggcacgcagtgtggattctgc
agcccagggatggtgatgtccatctacacactgctgaggaatcacccggagccagcccct
gagcagatcaccaaagctctgggaggtaatttgtgccactgcactggataccaaccaatt
gtagaaagtggaaaaactttctgtgaatcaactgtttgtgaactgaaaggatcaggaaaa
tgttgcatggatcaagaagatgggtctttggtgaatagatgggaaaaaatgtgcaccaaa
ctgtacgatgaagacgaattccagcccttggatccatcccaggagcctatcttccctcct
gaactcataagaatggcagaagatccaaacaagagaaggctaaccttccaaggggagaga
accacatggatcacccctgcaaccctgaacgaccttctggagctgaaagccaatttcccc
aaagccccgcttgtcatgggaaacacagaattgggacccaggattaaattcaaaaatgaa
ttccatccagtttttatatctccacttgggcttccagaactacattttgtgaacaccaca
gatgatggggtgacaatcggtgcgggatacagtctagcccagttgaatgataccttacat
tttatcgtttcggagcaaccgaaggagaagactaagacctatcgagctctgctgaagcat
ctgaggacacttgcaggagcccagattaggaatatggccactttaggaggacatgtggtg
agccggcctaatttttctgacctaaaccccattttagcagcaggaaatgctgccatcaat
ctgatatctaaaggacaacggcagattcctttaaatggtcctttccttgagagatcacct
gaggcggacttgaaatcagaagagattgtgtcatctgtttatattccctactccactcag
tggcactttgtgtttgggctccggatggcccagcgtcaagagaacgcatttgccattgtc
aatgctgggatgagcgtgaagtttgaagacggcacgaacacaatcaagaacttcaaatgt
tctatgaagcgtgggccccaccactgtctctgcaagccaaactgcaagcagctcattggg
aggcaatgggatgaccaaatgctgagtgatgcctgccgatgggtcctggatgagatctac
atcccaccagcagctgagggtggcatggtggagtacaggcgaaccctcatcatcagcctc
ctcttcaaattctacctgaaagtgaggcgaggactgaatcaaatggatccccagaagttt
cccgacattccagaaaagttcatgagtgctctagaagactttcccatagaaacaccccaa
ggaattcagatgtttcagtgtgtggatccccaccaacccccacaagatccagttggacac
ccagtcatgcaccagtcggccattaaacacaccacaggggaagctgtgtatattgacgac
atgccctgcatcgaccaagaactcttcctggctccaatcaccagcaccagagctcatgca
aagatcatatcaattgatatttcagaagccctggcacttccaggtgttgttgacgtgata
acagcagaggatgttccaggagataataactatcaaggagagattttctatgcacagaat
gagataatttgcgtgggtcagatcgtcggcactgtggccgctgatacctatgctcatgca
agagaggcagccaaaaaagtgaagatcgcttatgaagacatagagccaaggattatcaca
atagagcaagccctaaagcacaattcatttctttttgatgagaaaaaaatcgagcaagga
aatgtagagcaagcctttaaatatgttgaccaaatcattgaaggtgaagtccatgtggaa
ggacaggaacatttttatatggaaacatcgtctatcctggctctcccaaaagaagaagat
aaagaaatggtgttacaccttggaacacagtatccaacccgcgtgcaggaatatgtggct
gcagcactgaacgtcccaaggaatagaatcacctgccgcatgaaaagaactggaggagcg
tttggagggaaagtggccaaacctgctgtgctaggagctgtcagtgctgtggccgccaac
aagactggccgtccaatccggtttatcctagaacgtggtgatgacatgctgataactgct
ggccgccacccgctccttggaaaatacaaaattggattcatgaacaatggtgtgataaaa
cctgctgatgtcgaatactacgtcaatggcgggtgcactcctgatgagtctgagatggtg
gtggagttcattgtgctgaaatctgaaaatgcatactatattcctaatttccggtgccgg
ggtagggcttgcaaaacaaatttgccatccaacacagcctttcgaggatttggctttcct
cagggtacggtggtagtcgaagcttacataactgccgtggcatctcaatgcaacttaccc
cctgaagaggttaaagaaataaacatgtataagagaattagcaaaacagcctttaagcag
acatttaatccagagccattgcgaagatgctggaaagaatgtctggagaaatcttcattc
tatactaggaaactggccgcagaggaatttaacaaaaagaattactggaagaagagggga
cttgccatagtgcccatgaaattttgcattgggatccccacagcttactacaatcaggcg
gcagctctcgttcacatctatctagatggctctgtcttggtgactcatggtggctgtgaa
ctgggacaaggcctatataccaaaatgattcagggggctagtcacgaactcaatatcccc
cagtcatacatacacctgtctgaaacaagcacagtcacagtgcccaatggcgtcttcacg
tcgggatcaatggggacagacatcaatggaaaggctgtgcagaatgcctgccaagctctt
atggcccgtcttcatcccatcatcaggaaaaaccctaaaggaaaatgggaggattggatt
gcaaaagcctttgaaaaatccatcagtctctcagctactggatatttcaaaggctaccag
acaaatatggactgggagaagggggagggtaatgcttacccgtattatgtttatggagca
gcctgttctgaggttgaagtcgactgtctcacgggggctcataagcttcttaggaccgac
atcttcatggatgccgctttcagcataaacccagccctggatattggacaggttgaggga
gcatttattcaaggcatgggattctataccatagaagaactgaaatactccccagaaggt
gtgctttattctcggagtccagatgactacaaaatccccaccgtcactgagataccagaa
gagttctatgtcactttggtgcgttcccaaaatcccatagccatctactcatccaagggg
ttgggtgaggctggaatgttcttggggtcctccgtgttgtttgccatatatgacgcagtg
gctgctgcccgcagagagaggggcctagccaagaccttcgtcctgagtagcccggcaacc
cctgagatgattcggatgacttgtgtggatcagttcaccgacatgattcccagagatgac
ccttcaacatttacaccttggtccatccgtgtgtcttaa

KEGG   Macaca mulatta (rhesus monkey): 701613
Entry
701613            CDS       T01028                                 

Gene name
AOX2
Definition
(RefSeq) aldehyde oxidase 2
  KO
K00157  aldehyde oxidase [EC:1.2.3.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00280  Valine, leucine and isoleucine degradation
mcc00350  Tyrosine metabolism
mcc00380  Tryptophan metabolism
mcc00750  Vitamin B6 metabolism
mcc00760  Nicotinate and nicotinamide metabolism
mcc00830  Retinol metabolism
mcc00982  Drug metabolism - cytochrome P450
mcc01100  Metabolic pathways
mcc04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    701613 (AOX2)
   00350 Tyrosine metabolism
    701613 (AOX2)
   00380 Tryptophan metabolism
    701613 (AOX2)
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    701613 (AOX2)
   00760 Nicotinate and nicotinamide metabolism
    701613 (AOX2)
   00830 Retinol metabolism
    701613 (AOX2)
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    701613 (AOX2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    701613 (AOX2)
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     701613 (AOX2)
SSDB
Motif
Pfam: Ald_Xan_dh_C2 FAD_binding_5 Ald_Xan_dh_C Fer2_2 CO_deh_flav_C Fer2 DHODB_Fe-S_bind MMTV_SAg
Other DBs
NCBI-GeneID: 701613
NCBI-ProteinID: NP_001268244
Ensembl: ENSMMUG00000005835
UniProt: M1ZMK3
LinkDB
Position
12
AA seq 1345 aa
MRCASRSDELVFFVNGRKVMERNVDPEGTLLTFLRKNLRLTGTKYACGRGGCGACTVMVS
KHDPVSRKIRHFSVTACLVPICSLYGAAVTTVEGVGSIKTRLHPVQERIAKSHGTQCGFC
TPGMVMSMYTLLRNHPQPSEEQLTEALGGNLCRCTGYRPILESGRTFCMESNSCQQKGTG
KCCLDWGENDSSPLGKKNEICTKLFAKEEFQSLDPTQELIFPPELLRMAENPEKRTLTFY
GERVTWISPGTLKDLLELKVKHPEAPLVVGNTSLGPAMKSQRQFHPVLLSPARISELSMV
TKTSDGLTIGAGCSLAQTQDILAERIAELPEEKTQTYRALLKHLRSLAGQQIRNMASLGG
HVISRHCCSDLNPVLAVSNATLNLISAEGTRQIPLNEHFLAGLASADLKPEEILESVHIP
HSQKWEFVSAFRQAQCQQNALPHVNAGMRVLLKEGTDSIEDLSIAYGGVGAATISAHRSC
QQLLGRRWNELMLDEACRLLLDEVSLPGSAPGGRVEFKRTLVVSFLFKFYLEVLQELKKL
VKLFSVADSRHRSEVSDQFLSALEDFPVTIPQGVQTYQNVDPHQPLQDPVGRPIMHLSAL
KHATGEAMFCDDIPVVDKELFMALVTSSRAHAKIISIDVSKALELPEVVDVITAEDIPGT
NGAEGDKLLAAEEVTCVGQIICAVVAETDVQAKRATEKIEITYKDLEPVIFTIKDAIKHN
SFLCPEKKLEQGNVEEAFEKVDQTIEGEVHVGGQEHFYMETQRVLVIPKTEDKELDIYVS
TQDPAHVQKTVSSTLNIPINRITCHVKRVGGGFGGKVGKPAVFGAIAAVGAIKTGHPIRL
VLDREDDMLITGGRHPLFGKYKVGFTNNGRIKALDIECYINGGCTLDDSELVTEFLILKL
ENAYKIRNLRFRGRACMTNLPSNTAFRGFGFPQGALVTESCITAVAAKCGLPPEKIREKN
MYKTVDKTIYKQAFNPETLIRCWNECLDKSSFHSRRMQVEEFNKKNYWKKKGIAIIPMKF
SVGFAATSYHQAAALVHIYTDGSVLVTHGGNELGQGIHTKMLQVASRELKIPMSCIHISE
TSTATVPNTIATAASVGADVNGRAVQNACQILLKRLEPIIKKHPEGTWENWIEAAFEQRI
SLSATGYFRGYKAFMDWEKGVGDPFPYYVYGAACSEVEIDCLTGAHKKIRTDIIMDACCS
LNPAIDIGQIEGSFIQGMGLYTTEELKYSPEGILYSRSPDEYKIPTITDVPEEFNVSLLP
SSQTPLTIYSSKGLGESGMFLGSSVFFAIADAVATVRRERDIAEDFMVQSPATPERVRMA
CADRFTKMIPRDDPETFKPWSIPIA
NT seq 4038 nt   +upstreamnt  +downstreamnt
atgcgttgcgcatcacgatcagacgagctggttttcttcgtgaacgggaggaaggtgatg
gagaggaatgtggacccagaagggactctgctgaccttcctacgaaagaacttacgcctc
acaggaaccaagtacgcctgtggaagaggaggctgcggcgcctgcaccgtgatggtgtcc
aagcatgaccccgtgtccaggaagataagacacttctctgtcactgcatgcctggtgccc
atctgctctctgtatggagctgctgtcaccaccgtggaaggtgttggaagcatcaaaacc
aggcttcaccctgtacaggagcggatcgccaagagccacggcacccagtgtggattctgc
acccctgggatggtgatgtccatgtacacactgctcaggaaccacccgcagccctcggag
gagcagctcacagaagccttggggggtaatctatgccgctgcactgggtatcggccaata
cttgagagtggaaggactttctgcatggagtcaaatagctgtcaacagaaaggaacggga
aaatgttgcttggattggggagaaaatgactcttccccacttggcaagaaaaatgagatt
tgcacgaagttatttgcgaaagaggagtttcaatccttggacccaacccaggagctcata
tttcccccagaactcttgaggatggcagagaatccagaaaaacgaacactgaccttctat
ggagagagagttacctggatctctcctgggaccctcaaggatctcctggagctgaaagtg
aaacaccccgaggcccctctcgttgtgggcaacacctcactgggacctgcaatgaaatct
caaagacaatttcatccagttctcctctctcctgcaaggatctctgagctgagtatggtg
acaaaaacaagtgatggactgacaataggcgctggctgcagcctggcccagacgcaggac
atcttggctgagaggatagctgagctgccagaggagaaaacacagacgtaccgagccctc
ctgaagcacctgaggagtctggcaggccagcagatccggaatatggcatccttagggggc
catgtgataagccggcattgctgttcggacctgaatccagttcttgctgtgagcaatgct
accctcaatctgatttcagcagaaggtacgcggcagattcctctaaatgaacattttctt
gctgggttggcaagtgcagaccttaagccggaggaaattttggaatctgtgcatatcccg
cactctcaaaagtgggaatttgtgtccgccttccgacaggctcagtgccagcagaacgcc
ttgccccacgtgaatgccggcatgcgagtccttctcaaagaaggcacagacagcattgag
gacctgagcatcgcctatggaggggtgggggctgccaccatcagtgcacacagatcctgc
cagcagctccttgggaggcgctggaatgagttgatgctggatgaggcttgcaggctgctt
ctggatgaagtctcgctcccaggctcagccccaggtggccgggtggaattcaagaggacc
ctagtcgtcagcttcctcttcaaattctacctagaggttctgcaggaactgaagaagctg
gtgaagctgttctctgtggctgacagccgtcatcgttctgaagtttcagaccaattccta
agtgctctcgaagatttcccagtcacaataccccagggagtccaaacgtaccagaatgtg
gatcctcaccagcctctccaagacccagttggacgccccatcatgcacctgtcagctctt
aaacatgccactggggaagccatgttttgtgatgacattcccgtggtagataaagaactt
ttcatggctttggtgaccagtagcagggctcatgcaaaaatcatatcaattgatgtgtcc
aaggcccttgaactaccggaagtggttgatgtgataacagctgaagatattccaggcacc
aatggcgctgaaggtgacaaactgctggctgcagaggaggtaacctgtgtgggccagatc
atctgtgctgtggttgctgagacagatgtacaggcaaaacgagcaactgaaaagatagag
atcacctataaagatctggaacctgtaatcttcaccatcaaggatgccataaaacacaat
tcattcctgtgccctgaaaaaaaacttgaacaaggaaatgttgaggaggcctttgaaaaa
gtcgaccaaactattgaaggagaggtccatgttggaggacaggaacatttttacatggaa
acgcaaagagtgcttgttattccaaagacagaggacaaagaactggacatttatgtgtct
acacaggacccagcccacgtgcagaaaacagtgtcttctactttaaacatccccatcaac
aggatcacctgtcatgtaaaacgagtgggtggaggttttggagggaaggtaggaaaacca
gctgtattcggggcgattgcagctgtgggtgccatcaaaacaggtcatcccattcgtctt
gtccttgatcgtgaagacgatatgttaataactggaggaaggcacccattatttggaaaa
tataaagtaggattcacgaacaacgggcggatcaaagctctggacattgagtgctacatt
aatggaggatgcacgctggatgactctgagctggtaacagaatttctaatactaaagctg
gaaaatgcatataaaattcgcaacctcaggttccggggccgtgcatgcatgacaaattta
ccatccaatacagcctttcgtggatttggcttcccacaaggagccctagtaacagaatcg
tgcatcacagctgtggcagccaaatgtggccttccgccagaaaagattagagagaaaaat
atgtacaaaacagttgacaaaaccatctacaaacaagcattcaaccctgagaccctgata
agatgttggaatgaatgtctggacaagtcttcctttcacagcagaagaatgcaagtcgaa
gagttcaataagaagaattattggaagaagaaaggcattgctattattcccatgaagttt
tcagttggctttgctgcaacaagctatcatcaggcagctgcactggttcatatctacaca
gatgggtctgtgttggtcacacatggaggcaatgaactgggacaaggtattcacaccaaa
atgctgcaggtggccagccgtgagttaaaaatacccatgtcctgtatccacatctctgaa
acgagcacagcaacagtacctaatacaattgctacagcagcgtctgttggtgcagatgtc
aatggcagagctgtgcagaatgcttgtcagatccttctgaaacgccttgagcccatcatt
aagaaacatccggaaggtacatgggaaaactggatagaagctgcatttgaacaaagaatc
agtctctcagccactggatacttcaggggctacaaggccttcatggactgggagaagggg
gtgggggacccatttccttactatgtctatggagctgcctgttctgaggttgaaattgac
tgcctgacaggtgctcacaagaaaatcagaacggacatcatcatggatgcatgttgcagc
ctaaatccggccattgatattgggcagattgaaggttcgtttattcagggaatggggctt
tataccactgaagaactgaaatactccccagaaggcatcctgtactctcggagcccagat
gagtacaaaattccaaccatcactgatgtcccagaggagttcaatgtctccttgctgcca
tcatcacaaaccccactaaccatctattcatctaagggcctcggggagtctgggatgttc
ctggggtcatctgtgttctttgccattgctgacgctgtggccacagtgcgaagagaaaga
gacatagctgaggacttcatggtgcagagcccagcaacgccagaacgggttcgaatggcc
tgtgcagatcgattcaccaaaatgatcccaagagatgaccctgagacatttaaaccttgg
tctatccctatagcataa

DBGET integrated database retrieval system