KEGG   Macaca mulatta (rhesus monkey): 702288
Entry
702288            CDS       T01028                                 

Gene name
TIAM1
Definition
(RefSeq) T-lymphoma invasion and metastasis-inducing protein 1
  KO
K05731  T-lymphoma invasion and metastasis-inducing protein 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04024  cAMP signaling pathway
mcc04062  Chemokine signaling pathway
mcc04530  Tight junction
mcc04810  Regulation of actin cytoskeleton
mcc05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    702288 (TIAM1)
   04015 Rap1 signaling pathway
    702288 (TIAM1)
   04024 cAMP signaling pathway
    702288 (TIAM1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    702288 (TIAM1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    702288 (TIAM1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    702288 (TIAM1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    702288 (TIAM1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mcc04990]
    702288 (TIAM1)
Domain-containing proteins not elsewhere classified [BR:mcc04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   702288 (TIAM1)
SSDB
Motif
Pfam: RhoGEF Tiam_CC_Ex PH RBD PH_9 PDZ PDZ_2 PDZ_6 PH_11
Other DBs
NCBI-GeneID: 702288
NCBI-ProteinID: NP_001247701
Ensembl: ENSMMUG00000019571
UniProt: H9EU67 G7MSQ3
LinkDB
Position
3
AA seq 1591 aa
MGNAESQHVEHEFYGEKHASLGRKHTSRSLRLSHKTRRTRHASSGKVIHRNSEVSTRSSS
TPSIPQSLAENGLEPFSQDGTLEDFGSPIWVDRVDMGLRPVSYTDSSVTPSVDSSIVLTA
ASVQSMPDSEESRLYGDDATYLAEGGRRQHSYTSNGPTFMETASFKKKRSKSADIWREDS
LEFSLSDLSQEHLTSNEEILGSAEEKDCEEARGMETRASPRQLSTCQRANSLGDLYAQKN
SGVTANGGPGSKFAGYCRNLVSDIPNLANHKMPPAAAEETPPYSNYNTLPCRKSHCLSEG
ATNPQISHSNSMQGRRAKTTQDINAGEGSEFADSGIEGATADTDLLSRRSNATNSSYSPT
TGRAFVGSDSGSSSTGDAARQGVYENFRRELEMSTTNSESLEEAGSAHSDEQSSGTLSSP
GQSDILLTAAQGTVRKAGALAVKNFLVHKKNKKVESATRRKWKHYWVSLKGCTLFFYESD
GRSGIDHNSIPKHAVWVENSIVQAVPEHPKKDFVFCLSNSLGDAFLFQTTSQTELENWIT
AIHSACATAVARHHHKEDTLRLLKSEIKKLEQKIDMDEKMKKMGEMQLSSVTDSKKKKTI
LDQIFVWEQNLEQFQMDLFRFRCYLASLQGGELPNPKRLLAFASRPTKVAMGRLGIFSVS
SFHALVAARTGETGVRRRTQAMSRSASKRRSRFSSLWGLDTTSKKKQGRPSINQVFGEGT
EAVKKSLEGIFDDIVPDGKREKEVVLPNVHQHNPDCDIWVHEYFTPSWFCLPNNQPALTV
VRPGDTARDTLELICKTHQLDHSAHYLRLKFLIENKMQHYVPQPEEDIYELLYKEIEICP
KVTQSIHIEKSDTAADTYGFLLSSVEEDGIRRLYVNSVKETGLASKKGLKAGDEILEINN
RAADALNSSMLKDFLSQPSLGLLVRTYPELEEGVELLESPPHRVDGPADLGESPLAFLTS
NPGHSLCSEQGSSAETAPEETEGPDLESSDETDHSSKSTEQVAAFCRSLHEMNPSDQSPS
PQDSTGPQLATMRQLSDADKLRKVICELLETERTYVKDLNCLMERYLKPLQKETFLTQDE
LDVLFGNLTEMVEFQVEFLKTLEDGVRLVPDLEKLEKVDQFKKVLFSLGGSFLYYADRFK
LYSAFCASHTKVPKVLVKAKTDTAFKAFLDAQNPKQQHSSTLESYLIKPIQRILKYPLLL
RELFALTDAESEEHYHLDVAIKTMNKVASHINEMQKIHEEFGAVFDQLIAEQTGEKKEVA
DLSMGDLLLHTTVIWLNPPASLGKWKKEPELAAFVFKTAVVLVYKDGSKQKKKLVGSHRL
SIYEDWDPCRFRHMIPTEALQVRALASTDADANAVCEIVHVKSESEGRPERVFHLCCSSP
ESRKDFLKAVHSILRDKHRRQLLKTESLPSSQQYVPFGGKRLCALKGARPAMSRAVSAPS
KSLGRRRRRLARNRFTIDSDAVSASSPEKESQQPPGGGDTDRWVEEQFDLAQYEEQDDIK
ETDILSDDDEFCESVKGASVDRDLQERLQAASISQRERGRKTLDSHASRMAQLKKQAALS
GINGGLESASEEVIWVRREDFAPSRKLNTEI
NT seq 4776 nt   +upstreamnt  +downstreamnt
atgggaaacgcagaaagtcaacatgtagagcacgagttttatggagaaaagcatgccagc
ctggggcgcaagcacacgtcccgctccctccgcctctcgcacaagacgcggcggaccagg
cacgcttcctcggggaaggtgatccacaggaactccgaagtaagcacccgctccagcagc
acccccagcatcccccagtccctggctgaaaatggcctggagcccttctcccaagatggt
accctagaagacttcgggagccccatctgggtggaccgagtggacatgggcttgagacct
gtgtcttacactgactcttctgtcactcccagcgtagacagcagcatcgtgctcacggca
gcctctgtgcagagcatgccagactctgaggagagcaggctttacggggatgacgctaca
tatttggctgagggaggcaggaggcagcattcctatacatccaatgggcccactttcatg
gagacggcgagctttaagaagaaacgctccaaatctgcagacatctggcgggaggacagc
ctggaattctcactctctgatctgagccaagaacatttaacaagcaacgaagaaatcttg
ggttccgcggaagagaaggactgcgaggaggctcgggggatggaaacgcgggcgagtccg
cggcagctcagcacctgtcagagagccaattccttgggtgacttgtatgctcagaaaaac
tctggagtgacagcaaacggggggccggggagcaaatttgcaggctactgtcggaatttg
gtgtctgatattcccaatcttgcaaaccataagatgccaccagctgctgctgaagagact
cctccgtacagtaattataacacacttccctgtaggaaatctcactgtctctctgaaggt
gccaccaacccacaaattagccatagcaacagcatgcaaggcagaagagctaaaacaact
caggatattaatgcaggcgagggcagtgagtttgcagacagtgggattgaaggggccacc
gccgacacggacctcctgtccagacgatccaatgccaccaactccagctactcaccgacc
acaggccgggcctttgtgggcagcgacagcggcagcagctccaccggggatgcggctcgt
cagggggtgtacgagaacttccggcgggagctggagatgagcaccaccaacagcgagagc
ctggaggaggccggctcagcgcacagcgatgagcagagcagcggcaccctgagttccccg
ggccagtcggacatcctgctgactgccgcgcagggcacggtgcgtaaggccggtgccctg
gccgtcaagaacttcctggtgcacaagaagaacaagaaggtagagtcagccacccggagg
aagtggaagcactactgggtgtccctgaaaggatgcacgctatttttctacgagagcgac
ggcaggtctgggatagaccacaacagcatccccaaacacgccgtctgggtggagaacagc
attgtgcaggcggtgcctgagcaccccaagaaggactttgtcttctgcctcagcaattcc
ctgggtgatgccttcctttttcagaccactagccagacggagctcgaaaactggatcacc
gccatccactctgcctgcgccactgcagtcgcaagacaccaccacaaggaagacacgctc
cgactcttgaaatcagagatcaaaaaactggaacagaagattgacatggatgaaaagatg
aagaaaatgggtgaaatgcagctgtcttcagtcactgactcaaagaaaaagaaaacaata
ttagatcagatctttgtctgggaacaaaatctcgagcagttccaaatggacctctttcgt
ttccgctgttatttagccagcctgcagggtggggagctgccaaaccccaaaaggcttctt
gcttttgcaagtcgaccaacgaaagtggccatgggccgccttggaatcttttccgtatca
tcgtttcatgccctggtggcagcacgcactggtgaaactggagtgagaagacgtactcag
gccatgtccagatccgcaagcaagcgaaggagcaggttttcttctctgtggggcctggat
actacctccaaaaagaagcagggacgtccaagtatcaatcaggtgtttggagagggaacc
gaagctgtaaagaagtctttagaggggatatttgatgacattgttccagatggcaagagg
gagaaagaagtggtcttacctaacgttcaccagcacaaccctgactgcgacatttgggtc
cacgagtatttcactccatcctggttctgtctgcccaataatcagcctgccctgacggtc
gtccggccgggggacactgcacgggacaccctggagctgatttgcaagacacatcaactg
gatcattctgctcattacctgcgcctgaaatttctgatagaaaacaaaatgcagcactat
gttccacagcccgaggaagacatctatgagctgctatacaaagaaattgaaatctgtcca
aaagtcactcagagcatccacattgagaagtcagacacagctgccgatacttacgggttt
ttactttcttctgtggaagaagatggtattcgaaggctgtacgtgaatagtgtgaaggaa
accggtttagcttccaagaaaggtctgaaagcaggagatgagattcttgagatcaataat
cgtgctgctgacgccctgaactcttctatgctcaaagatttcctctcacagccctcgctg
ggcctcctggtgaggacctaccccgagctggaggaaggagtggagctgctggaaagccct
ccccaccgagtggacggccctgcggacctcggcgagagccccctcgcctttctcaccagc
aacccagggcacagcctctgcagtgagcagggcagcagtgctgagaccgctccagaggag
accgaggggccagacttggaatcctcagatgagactgatcatagcagcaagagtacagaa
caggtggctgcattttgccgcagtttgcatgagatgaacccctctgaccagagcccatct
cctcaggactccacgggccctcagctggcgaccatgagacaactctcggatgcggataag
ctgcgtaaggtgatctgtgagctcctggagacggagcgcacctatgtgaaggatttaaac
tgtctcatggagagatacctaaagcctcttcaaaaagaaacttttctcacccaagatgag
cttgacgtgctttttggaaatttaacggaaatggtggagtttcaagtagaattccttaaa
actctagaagatggagtgagactggtacctgatttggaaaagcttgagaaggtcgaccaa
tttaagaaagtgctgttctctctggggggatcgttcctgtattatgctgaccgcttcaag
ctctacagtgccttctgcgccagccacacaaaagttcccaaggtcctggtgaaagccaag
acagacacggctttcaaggcgttcttggatgcccagaacccgaagcagcagcactcatcc
acgctcgagtcgtacctcatcaagcccatccagaggatcctcaagtacccccttctgctc
agggagctgttcgccctgaccgatgccgagagcgaggagcactaccacctggacgtggcc
attaagaccatgaacaaggttgccagtcacatcaatgagatgcagaaaatccatgaagag
tttggggctgtgtttgaccagctgatcgctgaacagactggtgagaaaaaagaggttgca
gatctgagcatgggggacctgcttttgcacaccaccgtgatctggctgaacccgccggcc
tcgctgggcaagtggaaaaaggaaccagagctggcagcctttgttttcaaaactgctgtg
gtccttgtgtataaagatggttccaaacagaagaagaaacttgtgggatcccacaggctt
tccatttatgaggactgggacccctgcagatttcgacacatgatccccacggaagcgctg
caggttcgagctctggcaagtacagacgcagacgcaaatgccgtgtgtgaaattgtccac
gtcaaatccgagtctgaagggaggccggagagggtgttccacttgtgctgcagctccccg
gagagccgaaaggatttcctgaaggccgtgcattcaatcctgcgtgataagcacagaaga
cagctcctcaaaaccgagagccttccctcatcccagcaatatgtcccttttggagggaaa
agattgtgtgcactgaagggggccaggccggccatgagcagggcagtgtctgccccaagc
aagtctcttgggaggaggaggcggcggctggctcgaaacaggtttaccattgattctgat
gccgtctccgcaagcagcccggagaaagagtcccagcagccccccggtggtggggacact
gaccgatgggtagaggagcagtttgatcttgctcagtatgaggagcaagatgacatcaag
gagacagacatcctcagtgacgatgatgagttctgtgagtccgtgaagggcgcctcagtg
gacagagacctgcaggagcggcttcaggctgcctccatcagtcagcgggaaagaggccgg
aaaaccctggatagtcacgcgtcccgcatggcgcagctcaagaagcaagctgccctgtcg
gggatcaatggaggcctggagagcgcaagcgaggaagtcatttgggttaggcgcgaagac
tttgccccctccaggaaactgaacactgagatctga

DBGET integrated database retrieval system