KEGG   Macaca mulatta (rhesus monkey): 705313
Entry
705313            CDS       T01028                                 

Gene name
CD28
Definition
(RefSeq) T-cell-specific surface glycoprotein CD28 precursor
  KO
K06470  CD28 antigen
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04514  Cell adhesion molecules
mcc04660  T cell receptor signaling pathway
mcc04672  Intestinal immune network for IgA production
mcc04940  Type I diabetes mellitus
mcc05162  Measles
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcc05320  Autoimmune thyroid disease
mcc05322  Systemic lupus erythematosus
mcc05323  Rheumatoid arthritis
mcc05330  Allograft rejection
mcc05332  Graft-versus-host disease
mcc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    705313 (CD28)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    705313 (CD28)
   04672 Intestinal immune network for IgA production
    705313 (CD28)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    705313 (CD28)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    705313 (CD28)
   05323 Rheumatoid arthritis
    705313 (CD28)
   05320 Autoimmune thyroid disease
    705313 (CD28)
   05330 Allograft rejection
    705313 (CD28)
   05332 Graft-versus-host disease
    705313 (CD28)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    705313 (CD28)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    705313 (CD28)
  09172 Infectious disease: viral
   05162 Measles
    705313 (CD28)
CD molecules [BR:mcc04090]
 Proteins
  705313 (CD28)
SSDB
Motif
Pfam: V-set_2 V-set
Other DBs
NCBI-GeneID: 705313
NCBI-ProteinID: NP_001036106
Ensembl: ENSMMUG00000006017
UniProt: Q0PDN4
LinkDB
Position
12
AA seq 220 aa
MLRLLLALNLLPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLD
SAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPP
PYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWALVVVGGVLACYSLLVTVAFCIFWMR
SKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
NT seq 663 nt   +upstreamnt  +downstreamnt
atgctcaggctgctcttggctctcaacttactcccctcaattcaagtaacaggaaacaag
attttggtgaagcagtcgcccatgcttgtagcgtacgacaatgcagtcaaccttagctgc
aagtattcctacaatctcttctcaagggagttccgggcatcccttcataaaggactggat
agtgccgtggaagtctgtgttgtgtatgggaattactcccagcagcttcaggtttactca
aagacgggattcaactgtgatgggaaattgggcaatgaatcagtgacattctatctccag
aatttgtatgttaaccaaacagatatttacttctgcaaaattgaagtcatgtatcctcct
ccttacctagacaatgagaagagcaatggaaccattatccatgtgaaagggaaacacctt
tgtccaagccccctatttcctggaccttctaagcccttttgggcactggtggtggttggt
ggagtcctggcttgctatagcttgctagtaacagtggccttttgtattttctggatgagg
agtaagaggagcaggctcctgcacagcgactacatgaacatgactcctcgccgccccggg
cccacccgcaagcattaccagccctatgccccaccacgcgacttcgcagcctatcgctcc
tga

DBGET integrated database retrieval system