KEGG   Macaca mulatta (rhesus monkey): 707539
Entry
707539            CDS       T01028                                 

Gene name
MCL1
Definition
(RefSeq) induced myeloid leukemia cell differentiation protein Mcl-1
  KO
K02539  myeloid leukemia cell differntiation protein MCL-1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04151  PI3K-Akt signaling pathway
mcc04210  Apoptosis
mcc04630  JAK-STAT signaling pathway
mcc05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    707539 (MCL1)
   04151 PI3K-Akt signaling pathway
    707539 (MCL1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    707539 (MCL1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    707539 (MCL1)
SSDB
Motif
Pfam: Bcl-2 Bcl-2_3
Other DBs
NCBI-GeneID: 707539
NCBI-ProteinID: NP_001253430
Ensembl: ENSMMUG00000008221
UniProt: F7HUE9
LinkDB
Position
1
AA seq 350 aa
MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASARREIGGGEAGTVIGGS
AGASPPAALTPDARRVARPPPIGAEVPDVTASPARLLFFAPTRRASPLEEMEAPAADAIM
SPEEELDGYEPEPLGKRPAVLPLLELVGESGNSPSTDGSLPSTPPPAEEEEDELYRQSLE
IISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
NT seq 1053 nt   +upstreamnt  +downstreamnt
atgtttggcctcaaaagaaacgcggtaatcggactcaacctctactgtgggggggccggc
ttgggggccggcagcggcggcgccacccctccgggagggcggcttttggctacggagaag
gaggcctcggcccggcgagagatagggggaggggaggccggcacggtgattggcggaagc
gccggcgcaagccccccggccgccctcacgccagacgcccggagggtcgcgcggccgccg
cccattggcgcggaggtccccgacgtcaccgcgagccccgcgaggctgcttttctttgcg
cccacccgccgcgcgtcgccgcttgaggagatggaagccccggccgccgacgccatcatg
tcgcccgaagaggagctggacgggtacgagccggagcctctcgggaagcggccggctgtc
ctgcccctgctggagttggtcggggaatctggtaatagccccagtacggatgggtcacta
ccctcgacgccgccgccagcagaggaggaggaggacgagttgtaccggcagtcgctggag
attatctctcggtaccttcgggagcaggccaccggcgccaaggacacaaagccaatgggc
aggtctggggccaccagcaggaaggctctggagaccttacgacgggttggggatggcgtg
cagcgcaaccacgagacggccttccaaggcatgcttcggaaactggacatcaaaaacgaa
gacgatgtcaaatctttgtctcgagtgatggtccatgttttcagcgacggcgtaacaaac
tggggcaggattgtgactctcatttcttttggtgcctttgtggcgaaacacttgaagacc
ataaaccaagaaagctgcatcgaaccattagcagaaagtatcacagacgttctcgtaagg
acaaaacgggactggctagttaaacaaagaggctgggatgggtttgtggagttcttccat
gtagaggacctagaaggtggcatcagaaatgtgctgctggcttttgcaggtgttgctgga
gtaggagctggtttggcatatctaataagatag

DBGET integrated database retrieval system