KEGG   Monodelphis domestica (opossum): 103096087
Entry
103096087         CDS       T01031                                 

Gene name
IFI16
Definition
(RefSeq) interferon-inducible protein AIM2
  KO
K12966  absent in melanoma 2
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo04621  NOD-like receptor signaling pathway
mdo04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    103096087 (IFI16)
   04623 Cytosolic DNA-sensing pathway
    103096087 (IFI16)
SSDB
Motif
Pfam: HIN PYRIN TSLP
Other DBs
NCBI-GeneID: 103096087
NCBI-ProteinID: XP_016285767
Ensembl: ENSMODG00000027491
UniProt: K7DZU2
LinkDB
Position
2
AA seq 398 aa
MQFKITKRQLMMKLGRRTVIGLKSTEEMNKKFGEILLSGLEELQNEDFKKFKFFLSNDCL
MMRVHNLDRIDLATCMKKQLPCPSFMNKFIEILKKMNLNETAKKYKEQKEEVLKKLKKEN
EKKPTKRKNQAQTRKPSDGKNSVNPQLTKKDSLKLNDESKKNCGAKRTKATTEEKPESKK
RKLSEVSHQKTEPETGREDGPQTMPVVMKVLKVKEIFEYETKEKTKTMFHATVANEHEFI
RVKVLNIDVKEYFNQKNVIEISEGFWKSGFLEVNKSSKVIDLGANREMEVPQNIIRKASQ
TPKIQSLLKLKNKKERIYVDGVYEINKKTETDKCTIFVVKDNTGTIKVVTFGKWAKIKCD
ERDKLRLTCFELCVWDVKDEIQLKSVTHSYVKVIKAKK
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgcagttcaagataaccaaaaggcagctgatgatgaagctgggaagaaggactgtgatt
ggactaaaatcaactgaagagatgaataaaaaatttggggaaattttgctgagtggatta
gaagagctgcaaaatgaggactttaaaaaatttaaattctttttaagtaatgattgtttg
atgatgagagttcacaatcttgatagaattgatctagctacatgtatgaaaaaacagctt
ccttgtccctcttttatgaacaagttcattgaaatattaaaaaagatgaaccttaatgaa
actgctaagaagtataaagaacaaaaagaagaagtccttaagaaactgaaaaaggaaaat
gagaagaagccaacaaaaaggaaaaatcaggcccaaacgagaaaaccttctgatggcaaa
aatagtgttaaccctcagctgaccaagaaagatagtctgaaactcaatgatgagtcaaag
aaaaattgtggtgcaaagagaacaaaagcgacaactgaggagaagccagaaagcaaaaag
aggaagctatcggaagtatcccaccagaaaacagaacctgaaactggaagagaagatggg
ccccagacaatgcctgttgtcatgaaggtgctcaaagtgaaagagatatttgagtatgaa
actaaagaaaaaacgaaaacaatgtttcatgctactgtggcaaatgagcatgaattcata
cgggtgaaggttctcaacattgatgtcaaggaatacttcaaccaaaaaaatgtcattgag
atatcagaaggtttttggaagagcggtttcctagaagtaaacaaatcctccaaagtgata
gatttgggtgctaacagagaaatggaagtcccccaaaacatcatcagaaaagcatctcag
accccaaagatccaaagtcttttaaagcttaaaaataaaaaagagagaatctatgtggat
ggtgtctatgagattaataagaaaactgagacagacaaatgtacaatctttgtcgtgaag
gacaatacaggaacaattaaagtggtgacatttggcaaatgggccaaaataaagtgtgat
gaaagagacaagcttcgactcacctgctttgagctgtgtgtttgggatgtaaaagatgaa
atacagctgaaatctgtaactcacagttatgtaaaggtcatcaaggccaagaaatga

DBGET integrated database retrieval system