KEGG   Meleagris gallopavo (turkey): 100549497
Entry
100549497         CDS       T01523                                 

Gene name
APAF1
Definition
(RefSeq) apoptotic protease-activating factor 1 isoform X1
  KO
K02084  apoptotic protease-activating factor
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04115  p53 signaling pathway
mgp04210  Apoptosis
mgp05164  Influenza A
mgp05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100549497 (APAF1)
   04115 p53 signaling pathway
    100549497 (APAF1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    100549497 (APAF1)
   05168 Herpes simplex virus 1 infection
    100549497 (APAF1)
SSDB
Motif
Pfam: WD40 NB-ARC APAF1_C ANAPC4_WD40 CARD Ge1_WD40 CARD_2 eIF2A Nup160 WD40_like AAA_16 AAA_22 ZFYVE21_C
Other DBs
NCBI-GeneID: 100549497
NCBI-ProteinID: XP_003202214
Ensembl: ENSMGAG00000011573
LinkDB
Position
1
AA seq 1249 aa
MDAKSRTCLIRHRQALEKDIKTSYIMDCMVSDQVLTLQEEEKVKQQNTQKERAAMLIDTL
LKKDNNAYRSFYNALLHEGYRDLAALLQDGIPVFFSGNGKNTMDEMTSYVKTTLCEGGVP
QRPVVFVTRPKLVDAIKQKLCSLGSDPGWVTVYGMAGCGKTVLTAEALRDHQLLEGYFPG
GVHWISVGKQDKAGLLIKLQNLCSRLEHDSTLSQRPPLNIEEAKDRLRLLMLRKYPRSLL
VLDDIWDSWVLKAFDNHCQVLITSRDRSVTDAVSGNKYEIHVESGLTHEKGLEVLALFVN
MKISELPEQANCIIRECKGSPLVISLIGALLRDFPSRWEYYLKQLQNKQFKRIRKSSSYD
YEALDEAMSISVEQLSNDLKDYYKDLSILPKDVKVPTKVLCILWDMETEEVEDILQEFVN
KSLLFCDRNGNSFHYYLHDLQLDFLTEQNRNQLQELHKNIVNQYKRYYKLHVPVLSQEDC
MYWYNFLAYHMAGANMQKELRDLMFSLDWIKAKTELVGPAHLIHEYVEYSSVLDQKDSII
RENFQEFLSLNGHLLGRQPFPDITQLGLCQPETSEVYQQAKLRAQREMGTFYLEWINKKS
LKNLSRLVVRPHRDAVYHACFSRDRQRIASCGADKTLQVFKAESGERLLEISAHDDEILC
CTFSADDKYVATCSADKKVKIWNSRTGKCLYVYEEHTEQVNCCQFNNSRSQYLLATCSDD
TFIKLWNLKDKYCRNTMFGHVNAVSHCRFSPNDDYIASCSTDGTVKLWDVRSANELKTIE
IKEFFRNADEQQDDVEVLVKCCSWSRSSDTILVVAKNKLLLFDVTTCNLVTQVIISHHST
IQYCDFCAGDELVAVALSHCSVELWNIKSLSKVADCRGHMSWVHCVTFSSDGSLFLTSSE
DQTIRIWETNKVCKSSDAVLKSELDVVFHNGEVMILAIYNQKHIQLINGNTDSIIMQTEP
QESLICCCCLSEDLKFAAFGQENGEIKVLQLLDGKILTSQEAYKTSVQHCRFTTDCQTLI
SSAHDAVIQVWNWQLNECVFLRGHKEAIKDFAFLENSKLLSWSFDGTVKVWNITTGITEK
DFACHRGAVLSCAVSPDGSRFSSTSADKTAKIWSFESSSALHELKGHEACVRCSAFSPNN
KLLATGDDKGDIRIWDVLTGELLHFCSSVTVDEGEPTHGGWVTDLSFSPDSKMLVSSGGY
LKWWDVTTGESLQTFYTNGTNLKSIHVSPNFEVYVTVDNLGILYVLRKL
NT seq 3750 nt   +upstreamnt  +downstreamnt
atggatgcgaagagtagaacgtgtttaattaggcatcgtcaggcactggagaaagacatc
aaaacctcttacattatggattgtatggtttctgaccaagtcctgacattgcaggaggag
gagaaagtgaaacaacagaatacacagaaggagcgagcagctatgctaatagatactctt
cttaagaaagacaataatgcgtatagatctttttataatgcactgcttcatgaagggtac
cgagatcttgctgcacttcttcaggatggcattcctgtcttcttctctgggaatggaaag
aacactatggatgagatgacttcatatgttaagacaactctctgcgaaggaggtgtacca
cagagaccagttgtgtttgtcactcggccaaagctggtagatgctattaaacagaaactg
tgcagcttaggaagtgatccaggctgggtgacagtttatggaatggcaggttgtggaaag
accgttttaacagcagaagctttaagggatcaccagctcttggaaggttattttccagga
ggagttcactggatctctgtgggaaaacaggacaaagcaggactcctcataaaactacag
aatctttgtagtagattagagcatgactctactctttcacagagaccaccacttaatatc
gaggaggccaaagaccgtcttcgtttgctgatgctgcgcaaatacccgaggtctcttttg
gtcctggatgatatttgggattcctgggtgttaaaagcatttgataatcattgtcaggtt
cttatcaccagcagggacaggagtgtgacagatgctgtgtctggcaataaatatgagatt
catgtggaaagtggactaacgcatgagaaaggactggaagttttagccctgtttgtgaat
atgaaaatatccgaactgccagaacaagctaactgcattataagggaatgcaaaggttct
cctcttgtgatatccttgataggtgcattactacgagatttccctagtcgctgggaatac
tatctgaaacagttgcagaataagcaatttaaaagaataagaaaatcttcatcttacgac
tatgaagcccttgatgaagcaatgtccataagtgtagagcaactgagtaatgatttaaaa
gattactataaagacctctccatcctccctaaagatgttaaagtgcctactaaggtgctc
tgtattctttgggatatggaaactgaagaagttgaagatatactgcaggaatttgttaac
aaatcattattgttctgtgatcggaatgggaattcatttcattattatttgcatgatctt
caacttgactttcttacagaacagaatcgcaaccagcttcaggaactacataaaaacata
gtaaatcagtacaagaggtattacaagcttcatgtgcctgtgctatctcaagaagactgc
atgtactggtataactttctagcatatcacatggctggtgccaacatgcagaaggaactc
cgtgatcttatgttttctctagattggattaaagctaaaacagaattggtagggcctgca
catctaattcatgaatatgtagagtatagttcagtcctggatcaaaaggatagcatcata
cgtgagaattttcaggaatttttgtctttgaatgggcaccttcttggacgacagcctttt
cctgacattacccagctgggtctttgccaaccagagacatcagaggtgtaccaacaagcc
aagctgcgggctcaaagagaaatgggaacgttttacttggaatggataaataaaaaatcc
ttgaaaaacctttctcgtctggttgttcgtccgcatagagatgcagtttaccatgcctgc
ttttctagggatagacaaagaatagcatcatgcggagctgataaaacacttcaggtgttt
aaagcagaaagtggagagagattgctggagataagtgctcatgatgatgaaatactttgc
tgcactttttctgcagatgataaatacgtagctacttgttcagctgataaaaaagtgaag
atctggaattcaagaacaggcaagtgtttgtacgtatatgaagaacacacagagcaggtc
aattgctgccagttcaataacagcaggagtcagtatcttttagccacctgctcagatgac
actttcatcaaactttggaatctgaaggataagtattgtaggaatacgatgtttggtcat
gtaaacgctgtcagtcactgtagattttcaccaaatgatgactatattgctagctgctca
acagatggaacagtgaagctttgggatgtgcgatcagcaaatgaactgaaaactattgag
ataaaagaattcttcaggaatgcagatgagcagcaagatgatgtggaggttttagtaaaa
tgttgctcctggtccagaagtagtgatacaattttggtggtagccaaaaataagcttttg
ctttttgatgttacaacgtgtaatctggtaacacaagtcatcataagtcatcacagtaca
atccaatattgtgacttctgtgctggggatgagttagtagcagttgctttgtctcattgt
tctgttgagttatggaatattaaatccttatcaaaagtagcagattgcaggggacacatg
agctgggttcactgcgtgacattttcctcagatggatctttatttctcacatcttctgag
gaccagacaatacggatttgggaaacaaacaaggtgtgcaagtcttctgatgctgtgcta
aaaagtgaactggatgttgtatttcacaatggtgaagtcatgattttagcaatttacaat
cagaagcatattcaactcattaatggaaatacagacagcattatcatgcagacagaacct
caggaatcccttatttgctgctgttgcttaagtgaagatcttaaatttgcagcatttggg
caggagaatggagaaatcaaggtactgcagttgttggatgggaaaattctgacatcccag
gaggcctacaagacatctgtgcagcattgtcgatttaccactgattgtcagactctgatt
tcaagtgctcatgatgcagtcatacaggtctggaattggcagttgaacgagtgtgtgttt
ctaagagggcataaggaagcaatcaaagactttgcatttctggaaaattcaaaacttctt
tcctggtcattcgatggaacagttaaggtttggaatatcaccactggaataacagaaaaa
gattttgcttgccatagaggtgctgttctttcttgtgctgtctcacctgatggtagtagg
ttttcatctacttctgctgacaaaactgcaaagatatggagctttgaaagttcatctgct
cttcatgagttgaaaggtcatgaagcctgtgtgcggtgctctgctttctctcctaataac
aaattactggccactggagatgacaaaggagatataaggatttgggacgttttaacaggt
gaattacttcacttctgctcctcagttactgtggatgaaggagaaccaacacatggtggt
tgggtaacagacctctcgttttctcctgacagtaaaatgcttgtgtcatctggaggctat
cttaagtggtgggatgtaactactggagaatccttgcaaaccttctacacgaatggaaca
aacctcaaatcaatacacgtgtctcctaattttgaagtctacgtgactgttgataatctt
ggcattctttatgtattacggaagttgtga

DBGET integrated database retrieval system