KEGG   Microbacterium sp. No. 7: AOA12_03105
Entry
AOA12_03105       CDS       T04102                                 

Definition
(GenBank) hypothetical protein
  KO
K18287  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase [EC:4.1.2.56]
Organism
mio  Microbacterium sp. No. 7
Pathway
mio00997  Biosynthesis of various secondary metabolites - part 3
mio01100  Metabolic pathways
mio01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mio00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various secondary metabolites - part 3
    AOA12_03105
Enzymes [BR:mio01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.56  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase
     AOA12_03105
SSDB
Motif
Pfam: DeoC
Other DBs
NCBI-ProteinID: ALJ18947
UniProt: A0A0P0E2Z4
LinkDB
Position
680593..681483
AA seq 296 aa
MTAAYSGRTAIVSGGSPGKAIRLSRLLSGRGRSVFVPLDHSVTLGPIAGGVSTSALVSTF
ATAGVNAVIVHKGRVRTIDPALFTRLALIVHVSAGTRHHADNDSKVLVGDVDDAVRYGAD
AVSVHVNVGSANEPAQLRDLAAVAQRCDALGMPLLAMMYARRADLPEDQSAETLAHLSAI
AVDLGADLVKLSYPGSSEALSVVVGATPIPVLIAGGSVEPSVEANRERAHEVFAAGAAGV
CFGRSVFESDDPLRVASTLVSCAESYPLGPSLPSSLTELTRPGATSANPIDRRIPA
NT seq 891 nt   +upstreamnt  +downstreamnt
atgaccgctgcatactcgggccgaaccgccatcgtgagcgggggctcgcccggcaaggcg
atccgtctgtcgcgcctcctctccgggcgcgggcgcagcgtcttcgtgccgctcgaccac
tcggtcacgctgggccccatcgccggcggggtgtccacctcggcgctcgtgagcaccttc
gcgaccgcgggcgtcaacgccgtgatcgtgcacaaggggcgcgtgcgcacgatcgacccc
gcgctgttcacccggctcgccctcatcgtgcacgtctcggccggcacgcggcaccacgcc
gacaacgactcgaaggtgctcgtcggcgacgtcgacgacgccgtgcgctacggcgccgac
gccgtgagcgtgcacgtcaacgtcggctcggcgaacgagcccgcgcagctgcgcgacctc
gccgccgtcgcgcagcgctgcgacgcgctcggcatgcccctgctcgcgatgatgtacgcg
cgccgcgccgacctgcccgaggaccagagcgccgagacgctcgcgcacctctccgcgatc
gcggtcgacctcggcgccgacctggtgaagctctcgtacccgggcagctccgaggcgctc
agcgtcgtcgtcggcgccacgcccatccccgtcctcatcgccggcggcagtgtcgagccc
tcggtcgaggccaaccgcgagcgcgcgcacgaggtcttcgccgcgggcgccgcgggcgtg
tgcttcggccgcagcgtgttcgagtccgacgacccgctgcgcgtcgcgagcaccctcgtc
tcgtgcgccgagagctacccgctcggcccgtcacttccctcctcgctgaccgagctcacc
cgacccggggcgacgtcggcgaacccgatcgacaggagaatccccgcctga

DBGET integrated database retrieval system