Manis javanica (Malayan pangolin): 108384008 Help Entry 108384008         CDS       T06054                                  Symbol IFNG Name (RefSeq) interferon gamma   KO K04687   interferon gamma Organism mjv  Manis javanica (Malayan pangolin) Pathway mjv03050   Proteasome mjv04060   Cytokine-cytokine receptor interaction mjv04066   HIF-1 signaling pathway mjv04217   Necroptosis mjv04350   TGF-beta signaling pathway mjv04380   Osteoclast differentiation mjv04612   Antigen processing and presentation mjv04630   JAK-STAT signaling pathway mjv04650   Natural killer cell mediated cytotoxicity mjv04657   IL-17 signaling pathway mjv04658   Th1 and Th2 cell differentiation mjv04659   Th17 cell differentiation mjv04660   T cell receptor signaling pathway mjv04940   Type I diabetes mellitus mjv05140   Leishmaniasis mjv05142   Chagas disease mjv05143   African trypanosomiasis mjv05144   Malaria mjv05145   Toxoplasmosis mjv05146   Amoebiasis mjv05152   Tuberculosis mjv05160   Hepatitis C mjv05164   Influenza A mjv05168   Herpes simplex virus 1 infection mjv05200   Pathways in cancer mjv05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mjv05321   Inflammatory bowel disease mjv05322   Systemic lupus erythematosus mjv05323   Rheumatoid arthritis mjv05330   Allograft rejection mjv05332   Graft-versus-host disease mjv05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mjv00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     108384008 (IFNG)  09130 Environmental Information Processing   09132 Signal transduction    04350 TGF-beta signaling pathway     108384008 (IFNG)    04630 JAK-STAT signaling pathway     108384008 (IFNG)    04066 HIF-1 signaling pathway     108384008 (IFNG)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     108384008 (IFNG)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     108384008 (IFNG)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     108384008 (IFNG)    04612 Antigen processing and presentation     108384008 (IFNG)    04660 T cell receptor signaling pathway     108384008 (IFNG)    04658 Th1 and Th2 cell differentiation     108384008 (IFNG)    04659 Th17 cell differentiation     108384008 (IFNG)    04657 IL-17 signaling pathway     108384008 (IFNG)   09158 Development and regeneration    04380 Osteoclast differentiation     108384008 (IFNG)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     108384008 (IFNG)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     108384008 (IFNG)   09172 Infectious disease: viral    05160 Hepatitis C     108384008 (IFNG)    05164 Influenza A     108384008 (IFNG)    05168 Herpes simplex virus 1 infection     108384008 (IFNG)   09171 Infectious disease: bacterial    05152 Tuberculosis     108384008 (IFNG)   09174 Infectious disease: parasitic    05146 Amoebiasis     108384008 (IFNG)    05144 Malaria     108384008 (IFNG)    05145 Toxoplasmosis     108384008 (IFNG)    05140 Leishmaniasis     108384008 (IFNG)    05142 Chagas disease     108384008 (IFNG)    05143 African trypanosomiasis     108384008 (IFNG)   09163 Immune disease    05322 Systemic lupus erythematosus     108384008 (IFNG)    05323 Rheumatoid arthritis     108384008 (IFNG)    05321 Inflammatory bowel disease     108384008 (IFNG)    05330 Allograft rejection     108384008 (IFNG)    05332 Graft-versus-host disease     108384008 (IFNG)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     108384008 (IFNG)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     108384008 (IFNG)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03051 Proteasome [BR:mjv03051]     108384008 (IFNG)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mjv04052]     108384008 (IFNG)    00536 Glycosaminoglycan binding proteins [BR:mjv00536]     108384008 (IFNG) Proteasome [BR:mjv03051]  Eukaryotic proteasome   Assembling factors    Other assembling factors     108384008 (IFNG) Cytokines and neuropeptides [BR:mjv04052]  Cytokines   Interferons    108384008 (IFNG) Glycosaminoglycan binding proteins [BR:mjv00536]  Heparan sulfate / Heparin   Cytokines    108384008 (IFNG) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IFN-gamma API5 TssR_C Motif Other DBs NCBI-GeneID:  108384008 NCBI-ProteinID:  XP_017496291 LinkDB All DBs Position Unknown AA seq 166 aa AA seqDB search MNYTSYILVFQLCLILGSPSYYCQATFFTEIENLKEYFNANSPDVADGRPLFLDILKNWK EENDKKIIQSQIVSFYFKLFESLKDNQVVQKSMDVIKEDMFVKFFNSSTSKLDDFQKLIH IPVNDLKVQRKAISELIKVMNDLSPRSNLRKRKRSQSPFPGWRASK NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atgaattatacaagttatatcttagtttttcagctctgcctgattttgggttctcctagc tactactgccaggccacattttttacagaaatagaaaacctaaaggaatattttaatgca aatagtccagatgtagcagatggaaggcctcttttcttagatattttgaagaattggaaa gaggagaatgacaaaaaaataattcagagccaaattgtctccttctacttcaaactcttt gaaagcttaaaagataaccaggtggttcaaaagagcatggatgtcatcaaggaagacatg tttgttaagttcttcaacagcagcaccagcaagctggatgacttccaaaagctgattcac attccggtaaatgacctgaaggtccagcgcaaagcaatcagtgaactcatcaaggtgatg aatgatctgtcaccaagatccaacctaaggaagcggaaaaggagtcagagtccattccca ggctggagagcgtcaaaataa

DBGET integrated database retrieval system