KEGG   Manis javanica (Malayan pangolin): 108384008
Entry
108384008         CDS       T06054                                 

Gene name
IFNG
Definition
(RefSeq) interferon gamma
  KO
K04687  interferon gamma
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv03050  Proteasome
mjv04060  Cytokine-cytokine receptor interaction
mjv04066  HIF-1 signaling pathway
mjv04217  Necroptosis
mjv04350  TGF-beta signaling pathway
mjv04380  Osteoclast differentiation
mjv04612  Antigen processing and presentation
mjv04630  JAK-STAT signaling pathway
mjv04650  Natural killer cell mediated cytotoxicity
mjv04657  IL-17 signaling pathway
mjv04658  Th1 and Th2 cell differentiation
mjv04659  Th17 cell differentiation
mjv04660  T cell receptor signaling pathway
mjv04940  Type I diabetes mellitus
mjv05140  Leishmaniasis
mjv05142  Chagas disease
mjv05143  African trypanosomiasis
mjv05144  Malaria
mjv05145  Toxoplasmosis
mjv05146  Amoebiasis
mjv05152  Tuberculosis
mjv05160  Hepatitis C
mjv05164  Influenza A
mjv05168  Herpes simplex virus 1 infection
mjv05200  Pathways in cancer
mjv05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mjv05321  Inflammatory bowel disease
mjv05322  Systemic lupus erythematosus
mjv05323  Rheumatoid arthritis
mjv05330  Allograft rejection
mjv05332  Graft-versus-host disease
mjv05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    108384008 (IFNG)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    108384008 (IFNG)
   04630 JAK-STAT signaling pathway
    108384008 (IFNG)
   04066 HIF-1 signaling pathway
    108384008 (IFNG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108384008 (IFNG)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    108384008 (IFNG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    108384008 (IFNG)
   04612 Antigen processing and presentation
    108384008 (IFNG)
   04660 T cell receptor signaling pathway
    108384008 (IFNG)
   04658 Th1 and Th2 cell differentiation
    108384008 (IFNG)
   04659 Th17 cell differentiation
    108384008 (IFNG)
   04657 IL-17 signaling pathway
    108384008 (IFNG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108384008 (IFNG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108384008 (IFNG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108384008 (IFNG)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    108384008 (IFNG)
   05323 Rheumatoid arthritis
    108384008 (IFNG)
   05321 Inflammatory bowel disease
    108384008 (IFNG)
   05330 Allograft rejection
    108384008 (IFNG)
   05332 Graft-versus-host disease
    108384008 (IFNG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108384008 (IFNG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    108384008 (IFNG)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    108384008 (IFNG)
  09172 Infectious disease: viral
   05160 Hepatitis C
    108384008 (IFNG)
   05164 Influenza A
    108384008 (IFNG)
   05168 Herpes simplex virus 1 infection
    108384008 (IFNG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108384008 (IFNG)
   05144 Malaria
    108384008 (IFNG)
   05145 Toxoplasmosis
    108384008 (IFNG)
   05140 Leishmaniasis
    108384008 (IFNG)
   05142 Chagas disease
    108384008 (IFNG)
   05143 African trypanosomiasis
    108384008 (IFNG)
Proteasome [BR:mjv03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    108384008 (IFNG)
Cytokines and growth factors [BR:mjv04052]
 Cytokines
  Interferons
   108384008 (IFNG)
Glycosaminoglycan binding proteins [BR:mjv00536]
 Heparan sulfate / Heparin
  Cytokines
   108384008 (IFNG)
SSDB
Motif
Pfam: IFN-gamma API5
Other DBs
NCBI-GeneID: 108384008
NCBI-ProteinID: XP_017496291
LinkDB
Position
Unknown
AA seq 166 aa
MNYTSYILVFQLCLILGSPSYYCQATFFTEIENLKEYFNANSPDVADGRPLFLDILKNWK
EENDKKIIQSQIVSFYFKLFESLKDNQVVQKSMDVIKEDMFVKFFNSSTSKLDDFQKLIH
IPVNDLKVQRKAISELIKVMNDLSPRSNLRKRKRSQSPFPGWRASK
NT seq 501 nt   +upstreamnt  +downstreamnt
atgaattatacaagttatatcttagtttttcagctctgcctgattttgggttctcctagc
tactactgccaggccacattttttacagaaatagaaaacctaaaggaatattttaatgca
aatagtccagatgtagcagatggaaggcctcttttcttagatattttgaagaattggaaa
gaggagaatgacaaaaaaataattcagagccaaattgtctccttctacttcaaactcttt
gaaagcttaaaagataaccaggtggttcaaaagagcatggatgtcatcaaggaagacatg
tttgttaagttcttcaacagcagcaccagcaagctggatgacttccaaaagctgattcac
attccggtaaatgacctgaaggtccagcgcaaagcaatcagtgaactcatcaaggtgatg
aatgatctgtcaccaagatccaacctaaggaagcggaaaaggagtcagagtccattccca
ggctggagagcgtcaaaataa

DBGET integrated database retrieval system