KEGG   Melampsora larici-populina: MELLADRAFT_118380Help
Entry
MELLADRAFT_118380 CDS       T03138                                 

Definition
(RefSeq) hypothetical protein
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
mlr  Melampsora larici-populina
Pathway
mlr00562  Inositol phosphate metabolism
mlr01100  Metabolic pathways
mlr04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:mlr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    MELLADRAFT_118380
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    MELLADRAFT_118380
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mlr01009]
    MELLADRAFT_118380
Enzymes [BR:mlr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     MELLADRAFT_118380
    3.1.3.48  protein-tyrosine-phosphatase
     MELLADRAFT_118380
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     MELLADRAFT_118380
Protein phosphatases and associated proteins [BR:mlr01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    MELLADRAFT_118380
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTPlike_phytase DSPc Y_phosphatase3 Y_phosphatase CDKN3
Motif
Other DBs
NCBI-GeneID: 18926219
NCBI-ProteinID: XP_007417710
JGI: Mellp1_118380
UniProt: F4S8K8
LinkDB All DBs
Position
Unknown
AA seq 677 aa AA seqDB search
MNFDSIRKIVSGKKSRLVDQELGTDLDLSYITDRIIIMGYPASGLESLYRNRRKDVRRWL
EARHDKHYRIYNFCPRKENEYEASYFHNQVRRFPFPDHHAPPLSMIPLFVHNISHFLDSA
ADNIAVIHCKAGKGRSGTMTVCYLMTLASLPQPPRFKDLYIKSIQQLDEATTDKTQSSHS
HMAEIVDRDLQASQEDYKVSGTVKPTLSSGTRTQPIHADYAKMSLVASVHSERTRLKEAT
SPADTSIQVEGAPLRDESVAEIVDDLRTPRRVETSDLPSVRIQDQTSDLILMTRMAEKIL
SLFQFHTSRRMADPNSVPYGISIPSQRRSIRYWGDVLLGKDPRPAPGPQHNTIAGPQKIE
IRWIKVFVPETVRYAKVFTSKGKVAVQVGRFSLTLKALSLSTVVNLDHPSLYFHPSHAPD
VSTARPLFEGKNDDQDWEDQDEMIKAFASFGQEKRPLRKPKSLTAENPSSVPETIDSERR
SVELTRVPGSRASISTTYTTETSTSGSMIHIDDSQLEETLSNSFSDHDNENQEPIASQSR
YLTPVRLYDVPAWPTAEETPVFKKIKGGKNIDASGGIKIDADREILLRIVLGSTGKNHAS
LLPDATLLGYLWFIPAFHEPGLGTFSSTSRFAKAEENDEQREVDSSSDLIITSFPKEEID
FLNANISNIEVAWRRVP
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcgacagtatcagaaaaatcgtcagcggcaaaaagagccgattggtggatcaa
gagctgggcacagatctagatttatcgtatatcaccgataggatcatcataatgggctat
cctgctagcggacttgagagtctgtacagaaatcgcaggaaagacgtacgaagatggctg
gaagcacgtcacgacaaacattatcggatctataacttttgtccccggaaggaaaatgag
tatgaggcctcgtatttccacaaccaagttcgacggttcccttttcccgatcaccatgcc
ccaccactctcgatgatccctttgtttgtccacaacataagccacttcctcgactccgcg
gcggacaacatagcagtcattcattgcaaagctggaaagggaaggtcaggtacgatgact
gtatgttacctgatgacattggcttctctgccccagccgccacgcttcaaagatctttac
atcaaatctatacagcaactggatgaagcaactacagataagactcaatcctctcattct
cacatggccgaaattgtcgacagagatcttcaagctagtcaggaagattataaagtatct
ggtaccgtaaagccgactttgagttcaggaacgcgaacacaaccaattcatgcagattac
gctaaaatgagccttgtggcatccgtacacagtgagcgaacacgattgaaggaagcaacc
tccccagccgatacatcaatacaagtagagggcgcgccactccgtgatgagtccgtcgcc
gaaatagtagatgatttgcgaacgccgcgccgagtggaaacatctgatctcccatccgtc
agaatacaagatcaaacttcggatcttatattgatgactcgaatggccgagaagattcta
tctcttttccaattccacacaagcagaaggatggccgatccaaactcagtaccttatggt
ataagtattccgtctcaacggcgttctatccgatattggggggacgttctcttgggcaag
gatcctcgccctgccccaggaccacaacataataccatagcgggtccacaaaagattgag
atacgatggatcaaggtctttgtccctgaaacagtaagatacgcaaaagtatttacaagt
aagggcaaggttgctgtacaagtgggtagattctctctaacattgaaagcactctctctg
tcaactgttgttaatcttgatcatccgtcattatattttcacccgagccacgcacccgac
gtgtcaactgctcgccccctttttgaaggaaagaatgacgatcaggattgggaagatcag
gatgagatgataaaagcatttgcttcgttcggccaagagaagcgtcccctgcgaaagccg
aaatccttgacagctgaaaacccgtcaagcgtacctgagacaatcgattcagagagacgc
tcagtagagctaacccgagtcccaggtagtcgagcgtcaatctcaaccacatacaccacg
gaaacctctacatccggctccatgattcacattgatgatagccagctggaggaaactctt
tcaaacagcttttctgatcatgataacgaaaaccaagagccaatcgcatctcaatctcgt
taccttacgcccgttcgactctatgatgttccagcctggcccacagctgaggagacacct
gtgttcaagaagattaaaggcggaaagaacatcgatgcttctggtggaatcaaaatcgac
gctgatcgggagattctattgagaatagtacttggatcgactggaaagaaccacgcatcc
ctgctaccagatgccacgctcctaggatatctatggttcatacccgcatttcatgaacca
ggccttggaaccttttcatccacctcaaggtttgcaaaagcagaagagaacgatgagcaa
agagaagttgattcatcatcagatttgatcatcacttctttccccaaagaagagatagat
ttcctcaatgctaacataagtaatatagaagtagcttggaggagggtaccataa

DBGET integrated database retrieval system