KEGG   Mus musculus (mouse): 14103Help
Entry
14103             CDS       T01002                                 

Gene name
Fasl, APT1LG1, CD178, CD95-L, CD95L, Fas-L, Faslg, Tnfsf6, Tnlg1a, gld
Definition
(RefSeq) Fas ligand (TNF superfamily, member 6)
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01524  Platinum drug resistance
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04068  FoxO signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04210  Apoptosis
mmu04217  Necroptosis
mmu04650  Natural killer cell mediated cytotoxicity
mmu04722  Neurotrophin signaling pathway
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
mmu04940  Type I diabetes mellitus
mmu05142  Chagas disease (American trypanosomiasis)
mmu05143  African trypanosomiasis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05320  Autoimmune thyroid disease
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    14103 (Fasl)
   04010 MAPK signaling pathway
    14103 (Fasl)
   04068 FoxO signaling pathway
    14103 (Fasl)
   04151 PI3K-Akt signaling pathway
    14103 (Fasl)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    14103 (Fasl)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    14103 (Fasl)
   04217 Necroptosis
    14103 (Fasl)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    14103 (Fasl)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    14103 (Fasl)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14103 (Fasl)
   05205 Proteoglycans in cancer
    14103 (Fasl)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    14103 (Fasl)
   05330 Allograft rejection
    14103 (Fasl)
   05332 Graft-versus-host disease
    14103 (Fasl)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    14103 (Fasl)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    14103 (Fasl)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    14103 (Fasl)
   05162 Measles
    14103 (Fasl)
   05164 Influenza A
    14103 (Fasl)
   05161 Hepatitis B
    14103 (Fasl)
   05160 Hepatitis C
    14103 (Fasl)
   05168 Herpes simplex virus 1 infection
    14103 (Fasl)
   05163 Human cytomegalovirus infection
    14103 (Fasl)
   05165 Human papillomavirus infection
    14103 (Fasl)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    14103 (Fasl)
   05143 African trypanosomiasis
    14103 (Fasl)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    14103 (Fasl)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    14103 (Fasl)
   04052 Cytokines and growth factors [BR:mmu04052]
    14103 (Fasl)
   04090 CD molecules [BR:mmu04090]
    14103 (Fasl)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   14103 (Fasl)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Tumor necrosis fators
   14103 (Fasl)
CD molecules [BR:mmu04090]
 Proteins
  14103 (Fasl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF
Motif
Other DBs
NCBI-GeneID: 14103
NCBI-ProteinID: NP_034307
MGI: 99255
Ensembl: ENSMUSG00000000817
Vega: OTTMUSG00000050992
UniProt: P41047 Q544E9
LinkDB All DBs
Position
1 H2.1; 1 69.95 cM
AA seq 279 aa AA seqDB search
MQQPMNYPCPQIFWVDSSATSSWAPPGSVFPCPSCGPRGPDQRRPPPPPPPVSPLPPPSQ
PLPLPPLTPLKKKDHNTNLWLPVVFFMVLVALVGMGLGMYQLFHLQKELAELREFTNQSL
KVSSFEKQIANPSTPSEKKEPRSVAHLTGNPHSRSIPLEWEDTYGTALISGVKYKKGGLV
INETGLYFVYSKVYFRGQSCNNQPLNHKVYMRNSKYPEDLVLMEEKRLNYCTTGQIWAHS
SYLGAVFNLTSADHLYVNISQLSLINFEESKTFFGLYKL
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgcagcagcccatgaattacccatgtccccagatcttctgggtagacagcagtgccact
tcatcttgggctcctccagggtcagtttttccctgtccatcttgtgggcctagagggccg
gaccaaaggagaccgccacctccaccaccacctgtgtcaccactaccaccgccatcacaa
ccactcccactgccgccactgacccctctaaagaagaaggaccacaacacaaatctgtgg
ctaccggtggtatttttcatggttctggtggctctggttggaatgggattaggaatgtat
cagctcttccacctgcagaaggaactggcagaactccgtgagttcaccaaccaaagcctt
aaagtatcatcttttgaaaagcaaatagccaaccccagtacaccctctgaaaaaaaagag
ccgaggagtgtggcccatttaacagggaacccccactcaaggtccatccctctggaatgg
gaagacacatatggaaccgctctgatctctggagtgaagtataagaaaggtggccttgtg
atcaacgaaactgggttgtacttcgtgtattccaaagtatacttccggggtcagtcttgc
aacaaccagcccctaaaccacaaggtctatatgaggaactctaagtatcctgaggatctg
gtgctaatggaggagaagaggttgaactactgcactactggacagatatgggcccacagc
agctacctgggggcagtattcaatcttaccagtgctgaccatttatatgtcaacatatct
caactctctctgatcaattttgaggaatctaagacctttttcggcttgtataagctttaa

DBGET integrated database retrieval system