KEGG   Mus musculus (mouse): 217246Help
Entry
217246            CDS       T01002                                 

Gene name
Ace3, EG217246
Definition
(RefSeq) angiotensin I converting enzyme (peptidyl-dipeptidase A) 3
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04614  Renin-angiotensin system
mmu04924  Renin secretion
mmu05142  Chagas disease (American trypanosomiasis)
mmu05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    217246 (Ace3)
   04614 Renin-angiotensin system
    217246 (Ace3)
 09160 Human Diseases
  09165 Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    217246 (Ace3)
  09167 Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    217246 (Ace3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mmu01002]
    217246 (Ace3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    217246 (Ace3)
   04090 CD Molecules [BR:mmu04090]
    217246 (Ace3)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     217246 (Ace3)
Peptidases [BR:mmu01002]
 Metallo Peptidases
  Family M2
   217246 (Ace3)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   217246 (Ace3)
CD molecules [BR:mmu04090]
 Proteins
  217246 (Ace3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2 Cse1 DUF4131
Motif
Other DBs
NCBI-GeneID: 217246
NCBI-ProteinID: NP_001094923
MGI: 3644400
Ensembl: ENSMUSG00000101605
Vega: OTTMUSG00000033693
UniProt: D0G895
LinkDB All DBs
Position
11; 11 E1
AA seq 737 aa AA seqDB search
MNLPWALLLVLLSHRQLLPWLRTVGETSLNDFYSEAQAKLFLQFYEQTAQVVLNEFMEAT
WNYVTNITKQNQKNMLQKEADRSQFMLYFSTRARMFRTDHFLNQDVKRMLRKLQNIDKSA
LPTEDLLEYNRLLTYMETAYNRAEVCLDEGPCLTLEPDLQEIMATSRDQKELLWAWQGWR
DAVGRQLRPVFEDYVRLSNKAAQYNGYKDMGALWRSKYESDTLEEDLEQLYKELQPLYLN
LHAYVRRSLYRYYGPELIDLRGPIPAHLLGNMWAQSWNNILDLVLPYPTKAPEDITAIMK
IQHWRPEKMFEEANLFFTSMGMLPAPPAFWIKSMMEKPADGREVECHTSSWNFYKFNDFR
VKKCTEVTLEDLLSVFHQMGHIQYFLQYQNLSVIYQEGASPAFEEAVGSVIALSVSSHKY
LLARGLLSQPHQDSEEEVNFLLGIALEKIAFIPFSYLVDKFRWKIFDGTISKITYNQEWW
NFRLKYQGLCPPVPRSDDDFDPGAKFHIPANVPYIRYFLGLILQFQLHEALCEASGHVGP
LHQCDNYNSKVAGKILGDLLKLGSSRPWREVLQEVTGESNISTKAFLTYFKPLMDWLVTE
NVKQGDTLGWPDFSCSFEEKITSKVSFLGTDTEPEQAYLGQWVLLSMSFFMLVLILALGF
RLHYLEKQLLDEDTMILKTLPYSYFLGIAMEPHQAARKQWLLLGLCCILMLCCIGLLIRI
VTQNTENTPWMKNEGQS
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgaacttgccctgggccttgctacttgtgctcctctctcaccggcaactcttgccatgg
ctcaggactgtgggagagacaagcttaaatgatttctacagcgaggctcaggctaagttg
ttcctgcagttttatgagcaaacagcccaggtcgtgttgaatgagtttatggaagccact
tggaactacgtcaccaacatcaccaagcagaatcaaaagaacatgctgcagaaggaggcg
gacaggtctcagtttatgttatacttcagcacccgggcccgcatgtttaggacagaccat
ttcctgaaccaggacgtgaagcgcatgctgaggaagctgcagaacatagacaagtcggcc
ttgcccacggaggatctcctagagtacaacagacttctgacctacatggagacagcatat
aaccgagctgaggtgtgcctggatgagggtccctgcttgaccctagagcctgacctccaa
gaaatcatggccacctccagggaccagaaggagctgctgtgggcctggcagggctggcgg
gatgctgttggccgacaactccgccctgtctttgaggactacgtacgtctcagcaacaag
gctgcccaatataatggatacaaagacatgggggctttatggcgatccaagtatgaatct
gacacgctggaggaagacctagagcagctctataaggagctgcagcctctctacctgaac
ctccatgcctatgtgcgccgctcactgtaccgctactacgggcctgagctcattgacctg
agggggcccatccctgcccacctcctggggaacatgtgggctcagtcctggaataatatc
ctagatctggtcctgccctatccgactaaagccccagaggacatcacagcgatcatgaag
atccagcactggaggcctgagaaaatgtttgaagaggctaacttattctttacctcaatg
ggcatgctacccgccccgcctgctttctggataaagtctatgatggagaagccagctgac
gggcgggaagtggagtgccacacctcatcctggaacttctacaagttcaatgacttcagg
gtaaagaagtgcacggaagtgaccttagaagacctgctctccgtcttccaccagatgggc
catatccagtacttcttgcagtatcagaatctctctgtcatctaccaggaaggtgccagc
ccagcctttgaagaggctgtggggtcggtgatcgccctctcagtctcttcccacaagtac
ctgctcgccagaggtctgctcagccaacctcaccaggattcagaggaggaggtcaacttc
ctgttaggcattgccctggagaagattgccttcatccccttcagctacctggtagacaag
tttcgttggaagatctttgatggcactatttcgaagattacatacaaccaggagtggtgg
aacttcaggttgaagtaccaaggcctgtgcccacctgtccctcgatcagacgatgatttt
gacccaggtgccaagtttcacatccctgccaatgtgccctatatccgatactttcttggt
ctgatactgcagtttcaacttcatgaagcactatgcgaagcctccggccacgtgggccct
ctgcaccagtgcgataactacaactccaaggttgcagggaagatcttgggggatctcctg
aagttgggctccagccggccctggcgggaggtcctccaggaggtgactggagagtccaat
atatccaccaaggcctttttgacctacttcaagccactgatggactggctggtgactgaa
aacgtgaagcaaggggacacccttggctggccagacttcagctgttcttttgaagaaaaa
atcacaagcaaagtatcgtttctgggcacagacacagagcctgagcaggcgtacctgggg
cagtgggtgttgctgagcatgagttttttcatgttggtcctcatcctggcactgggcttc
aggctgcactacttggaaaaacagttactggacgaagacacaatgattcttaagaccctg
ccctactcctacttcctgggcatagccatggaaccccatcaggcagcccggaaacagtgg
cttctgctgggcctctgctgcatccttatgctgtgctgtattggcctgctcattcggata
gtcacgcagaacaccgagaacactccatggatgaaaaatgaagggcagagctga

DBGET integrated database retrieval system