KEGG   Miniopterus natalensis: 107524380
Entry
107524380         CDS       T05883                                 

Definition
(RefSeq) group 10 secretory phospholipase A2-like
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
mna  Miniopterus natalensis
Pathway
mna00564  Glycerophospholipid metabolism
mna00565  Ether lipid metabolism
mna00590  Arachidonic acid metabolism
mna00591  Linoleic acid metabolism
mna00592  alpha-Linolenic acid metabolism
mna01100  Metabolic pathways
mna04014  Ras signaling pathway
mna04270  Vascular smooth muscle contraction
mna04972  Pancreatic secretion
mna04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107524380
   00565 Ether lipid metabolism
    107524380
   00590 Arachidonic acid metabolism
    107524380
   00591 Linoleic acid metabolism
    107524380
   00592 alpha-Linolenic acid metabolism
    107524380
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107524380
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107524380
  09154 Digestive system
   04972 Pancreatic secretion
    107524380
   04975 Fat digestion and absorption
    107524380
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107524380
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     107524380
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    107524380
SSDB
Motif
Pfam: Phospholip_A2_1
Other DBs
NCBI-GeneID: 107524380
NCBI-ProteinID: XP_016051781
LinkDB
Position
Unknown
AA seq 141 aa
MSIFLNTSLKSHVHRRGLVELAKTIDCVGPRNPLVYISYGCYCGLGGHGQPLDDIDRCCH
RHDCCYRHAKLEAGCRAKLESYSWKCIDQRIECGPTEDKCQELLCKCDQEIAYCLAKTEY
HLKYLFYPRFLCGQDSLKCDD
NT seq 426 nt   +upstreamnt  +downstreamnt
atgtcaattttccttaatacctccttgaagtcacatgtgcatcgacgtggtctcgtagaa
ctggcaaagaccatagactgtgtcggcccccgcaatcccctggtctatattagctatggc
tgctattgtggactgggtggccatggccagcccctggatgacattgaccggtgctgtcat
cgtcatgactgctgctaccgacatgccaagttggaggctggctgcagggccaagctggag
tcctattcctggaagtgcatcgatcagcgcattgaatgtggaccaacagaggacaaatgt
caagaactcttgtgcaagtgtgaccaggagattgcttactgcttagccaaaactgagtac
catttaaagtacctcttctatccacgtttcttatgtgggcaggactcactcaagtgtgat
gactag

KEGG   Miniopterus natalensis: 107526176
Entry
107526176         CDS       T05883                                 

Gene name
PLA2G3
Definition
(RefSeq) LOW QUALITY PROTEIN: group 3 secretory phospholipase A2
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
mna  Miniopterus natalensis
Pathway
mna00564  Glycerophospholipid metabolism
mna00565  Ether lipid metabolism
mna00590  Arachidonic acid metabolism
mna00591  Linoleic acid metabolism
mna00592  alpha-Linolenic acid metabolism
mna01100  Metabolic pathways
mna04014  Ras signaling pathway
mna04270  Vascular smooth muscle contraction
mna04972  Pancreatic secretion
mna04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107526176 (PLA2G3)
   00565 Ether lipid metabolism
    107526176 (PLA2G3)
   00590 Arachidonic acid metabolism
    107526176 (PLA2G3)
   00591 Linoleic acid metabolism
    107526176 (PLA2G3)
   00592 alpha-Linolenic acid metabolism
    107526176 (PLA2G3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107526176 (PLA2G3)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107526176 (PLA2G3)
  09154 Digestive system
   04972 Pancreatic secretion
    107526176 (PLA2G3)
   04975 Fat digestion and absorption
    107526176 (PLA2G3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107526176 (PLA2G3)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     107526176 (PLA2G3)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    107526176 (PLA2G3)
SSDB
Motif
Pfam: Phospholip_A2_2 Chromadorea_ALT
Other DBs
NCBI-GeneID: 107526176
NCBI-ProteinID: XP_016054045
LinkDB
Position
Unknown
AA seq 514 aa
MRLLGMLLGVLSFLGAALGGSSALHWKSTSCHLARSIPGSSLGSLSFLGKDAQGLALFHT
HWDGNGRLQSCSQQDEPELTAAFSALCAGEITQDSFIRTPGPELQRALATLQSQWEACRP
SDGSPQGVRRKRAAGQSGTPGEGHQRGKRGWTMPGTLWCGVGDSARNSTELGVFQGPDLC
CREHDRCPQTISPFQYNYGIRNYRFHTISHCDCDARFQQCLQNQQDSISDIVGVAFFNVL
EIPCFVLEEQEACVAWYWWGGCRMYGSIPLARLQPKTLYNASWSSPAIPLTPSPQSPAPS
KPQQKQHPWKWPPQQGGSQHPSKDNATALQTPMASPRPDMASSGWLEITHPGLQRQQGAL
KPQVAHQACRSFRHLDKCEHQIGPQETKFQLLNSAREPLFHCNCTRRLARFLRLHSPPTG
ANILWELLGTTCFKLAPPLDCAESKDCSKGPRAVKVSARHLRRLQQRRLWGTGTDERQAW
PSEYPRSSMSFYDRCVQLTQAAXEPKEQQKSWNQ
NT seq 1545 nt   +upstreamnt  +downstreamnt
atgaggcttctaggaatgcttttgggggtgctgagcttcctgggggctgctctggggggc
tcttctgccctccactggaaaagcacctcctgccacttggccagatccatccctggtagt
tccttggggtccctaagcttcctgggcaaggatgcccagggactggctctgttccacacc
cactgggatgggaacgggaggctgcagtcatgtagccagcaggatgagccggagctcact
gcagccttcagtgcactctgtgctggtgagatcacccaggactccttcatccgcacccct
ggacctgagctgcagagagccctggccacccttcagagtcagtgggaggcctgccgacca
tctgatgggagtccccaaggagtgaggaggaagcgagcggcagggcagagtggaacacct
ggcgaagggcaccagcgggggaagagaggctggaccatgcctggcacactgtggtgtgga
gtcggggactctgccaggaactccacggagctgggggtcttccagggccctgatctctgc
tgccgggaacatgaccgctgcccacagaccatctcgcctttccagtacaactatggcatc
cgaaactaccgattccacaccatctctcactgtgactgtgatgccagattccagcaatgc
ctgcagaaccagcaggactccatctcagatatcgtgggtgtggctttcttcaatgtgctc
gagatcccctgctttgtgctggaggagcaggaggcgtgcgtggcatggtactggtggggc
gggtgcagaatgtatggctccatacctcttgcccgcctccagcctaagaccctctacaat
gcctcctggagctccccagccatccccctgactcctagcccccagagcccagcccccagc
aagccacaacagaagcagcatccttggaaatggccaccacagcagggaggatcccaacac
cccagcaaagacaatgccacagctctccagacccccatggcctcccctaggcctgatatg
gcctcctcaggctggttggagatcacccatccaggccttcagaggcaacagggtgcccta
aaacctcaggttgcccaccaggcctgccgcagcttccgccacctggacaagtgtgagcac
cagatcgggccccaggagaccaagttccagctgctcaatagtgcccgagagcccctcttc
cactgcaactgcacgcgccgactagcacgattcctgaggctccacagcccacccacaggt
gccaacatactttgggaacttctgggcacgacctgcttcaagctggcccctccactggac
tgtgctgagagcaaagactgttccaagggccctagggccgtcaaagtgtcagctcggcac
ttgcgacgacttcagcagaggagactctggggtacaggcacagatgagaggcaggcatgg
ccttcagagtacccaaggtcctccatgtcattctatgaccggtgcgtgcaactgacccag
gcagcttgagaacccaaagagcagcagaaatcctggaaccagtga

KEGG   Miniopterus natalensis: 107528479
Entry
107528479         CDS       T05883                                 

Gene name
PLA2G1B
Definition
(RefSeq) phospholipase A2
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
mna  Miniopterus natalensis
Pathway
mna00564  Glycerophospholipid metabolism
mna00565  Ether lipid metabolism
mna00590  Arachidonic acid metabolism
mna00591  Linoleic acid metabolism
mna00592  alpha-Linolenic acid metabolism
mna01100  Metabolic pathways
mna04014  Ras signaling pathway
mna04270  Vascular smooth muscle contraction
mna04972  Pancreatic secretion
mna04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107528479 (PLA2G1B)
   00565 Ether lipid metabolism
    107528479 (PLA2G1B)
   00590 Arachidonic acid metabolism
    107528479 (PLA2G1B)
   00591 Linoleic acid metabolism
    107528479 (PLA2G1B)
   00592 alpha-Linolenic acid metabolism
    107528479 (PLA2G1B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107528479 (PLA2G1B)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107528479 (PLA2G1B)
  09154 Digestive system
   04972 Pancreatic secretion
    107528479 (PLA2G1B)
   04975 Fat digestion and absorption
    107528479 (PLA2G1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107528479 (PLA2G1B)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     107528479 (PLA2G1B)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    107528479 (PLA2G1B)
SSDB
Motif
Pfam: Phospholip_A2_1 Parvo_coat_N Phospholip_A2_2
Other DBs
NCBI-GeneID: 107528479
NCBI-ProteinID: XP_016057048
LinkDB
Position
Unknown
AA seq 146 aa
MRLLVLAALLTVCAAEGGVSTRALWQFRNMIKCVIPDSDPLKDYNNYGCYCGLGGSGTPV
DELDQCCQTHDRCYDQAKKLDSCKFLLDNPYTKSYSYKCSGSEITCSSKNTPCQAFICNC
DRNAAICFSKAPYNNENKNLDTKKYC
NT seq 441 nt   +upstreamnt  +downstreamnt
atgagactccttgtgctggctgctctgcttacagtgtgtgccgcagagggcggcgtgagc
acgcgggcactgtggcagttccgcaacatgatcaagtgcgtgattcctgacagcgacccc
ttgaaagattacaacaactacggctgctactgtggcctgggaggatccggcacccctgtg
gatgaactggaccagtgctgccagacacacgaccgctgctacgaccaagccaagaagctg
gacagctgcaaattcctcctggacaacccctacaccaaaagctactcatacaaatgctct
ggctcagagatcacctgcagcagcaaaaacacaccctgccaggccttcatctgcaactgt
gaccgcaatgctgccatctgcttttcaaaggccccatacaacaacgagaacaagaacctg
gacaccaagaagtactgttaa

KEGG   Miniopterus natalensis: 107534370
Entry
107534370         CDS       T05883                                 

Gene name
PLA2G12A
Definition
(RefSeq) group XIIA secretory phospholipase A2
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
mna  Miniopterus natalensis
Pathway
mna00564  Glycerophospholipid metabolism
mna00565  Ether lipid metabolism
mna00590  Arachidonic acid metabolism
mna00591  Linoleic acid metabolism
mna00592  alpha-Linolenic acid metabolism
mna01100  Metabolic pathways
mna04014  Ras signaling pathway
mna04270  Vascular smooth muscle contraction
mna04972  Pancreatic secretion
mna04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107534370 (PLA2G12A)
   00565 Ether lipid metabolism
    107534370 (PLA2G12A)
   00590 Arachidonic acid metabolism
    107534370 (PLA2G12A)
   00591 Linoleic acid metabolism
    107534370 (PLA2G12A)
   00592 alpha-Linolenic acid metabolism
    107534370 (PLA2G12A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107534370 (PLA2G12A)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107534370 (PLA2G12A)
  09154 Digestive system
   04972 Pancreatic secretion
    107534370 (PLA2G12A)
   04975 Fat digestion and absorption
    107534370 (PLA2G12A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107534370 (PLA2G12A)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     107534370 (PLA2G12A)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    107534370 (PLA2G12A)
SSDB
Motif
Pfam: PLA2G12
Other DBs
NCBI-GeneID: 107534370
NCBI-ProteinID: XP_016064944
LinkDB
Position
Unknown
AA seq 183 aa
MEVDDPVLVLTAALRCQEEAQSTDWRATLKTIRNGVHKIDTYLNAALDLLGGEDGLCQYR
CSDGSKPFPRYGYKPSPPNGCGSPLFGVQLNIGIPSLTKCCNHHDRCYETCGESKNDCDE
EFQRCLSKICREVQKTLGLAQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCRYEEK
TDL
NT seq 552 nt   +upstreamnt  +downstreamnt
atggaggtggatgacccagtcctcgtcctgaccgccgcgctcaggtgccaggaggaggcc
cagtccaccgactggagggccaccctgaagaccatccggaacggcgttcacaagatcgac
acgtacctgaacgccgccttggacctgctggggggcgaggacgggctgtgccagtatagg
tgcagcgacggatctaagcctttcccgcgttatggttataaaccctccccgccgaatgga
tgtggctctccactatttggtgttcagcttaatattggcatcccttccctgaccaagtgc
tgcaaccaccacgacaggtgctacgagacctgcggggaaagcaagaacgactgtgacgag
gagttccagcgctgcctctccaagatctgccgcgaggtgcagaagacgctgggactggcc
cagcacgtgcaggcatgtgaaacaacagtggagctcttgtttgacagtgttatacattta
ggctgtaaaccgtacctggacagccagcgagccgcatgtaggtgtcgctatgaagaaaaa
actgatctttaa

KEGG   Miniopterus natalensis: 107536544
Entry
107536544         CDS       T05883                                 

Gene name
PLA2G4D
Definition
(RefSeq) cytosolic phospholipase A2 delta
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
mna  Miniopterus natalensis
Pathway
mna00564  Glycerophospholipid metabolism
mna00565  Ether lipid metabolism
mna00590  Arachidonic acid metabolism
mna00591  Linoleic acid metabolism
mna00592  alpha-Linolenic acid metabolism
mna01100  Metabolic pathways
mna04010  MAPK signaling pathway
mna04014  Ras signaling pathway
mna04072  Phospholipase D signaling pathway
mna04217  Necroptosis
mna04270  Vascular smooth muscle contraction
mna04370  VEGF signaling pathway
mna04611  Platelet activation
mna04664  Fc epsilon RI signaling pathway
mna04666  Fc gamma R-mediated phagocytosis
mna04724  Glutamatergic synapse
mna04726  Serotonergic synapse
mna04730  Long-term depression
mna04750  Inflammatory mediator regulation of TRP channels
mna04912  GnRH signaling pathway
mna04913  Ovarian steroidogenesis
mna04921  Oxytocin signaling pathway
mna05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107536544 (PLA2G4D)
   00565 Ether lipid metabolism
    107536544 (PLA2G4D)
   00590 Arachidonic acid metabolism
    107536544 (PLA2G4D)
   00591 Linoleic acid metabolism
    107536544 (PLA2G4D)
   00592 alpha-Linolenic acid metabolism
    107536544 (PLA2G4D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107536544 (PLA2G4D)
   04014 Ras signaling pathway
    107536544 (PLA2G4D)
   04370 VEGF signaling pathway
    107536544 (PLA2G4D)
   04072 Phospholipase D signaling pathway
    107536544 (PLA2G4D)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107536544 (PLA2G4D)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107536544 (PLA2G4D)
   04664 Fc epsilon RI signaling pathway
    107536544 (PLA2G4D)
   04666 Fc gamma R-mediated phagocytosis
    107536544 (PLA2G4D)
  09152 Endocrine system
   04912 GnRH signaling pathway
    107536544 (PLA2G4D)
   04913 Ovarian steroidogenesis
    107536544 (PLA2G4D)
   04921 Oxytocin signaling pathway
    107536544 (PLA2G4D)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107536544 (PLA2G4D)
  09156 Nervous system
   04724 Glutamatergic synapse
    107536544 (PLA2G4D)
   04726 Serotonergic synapse
    107536544 (PLA2G4D)
   04730 Long-term depression
    107536544 (PLA2G4D)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107536544 (PLA2G4D)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    107536544 (PLA2G4D)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     107536544 (PLA2G4D)
SSDB
Motif
Pfam: PLA2_B cPLA2_C2 C2
Other DBs
NCBI-GeneID: 107536544
NCBI-ProteinID: XP_016067780
LinkDB
Position
Unknown
AA seq 817 aa
MERLTPREPPGHPHQREASACWRLTVRVLEARGLGWTDVLSEADPYVVLQMPTAPGIKFK
TKTVTNSSHPVWNESFSFLIQRQVKNVLELSVYDEDSVTEDDACFKFLYDISEVLPGKLL
RKTFSLRPQGQEELDVEFLMEKTSDRPENLITNNVLVARELSCLDIRLESMGSTAVVSNQ
ENLELELVLKGSYEDTQTSALGTASAFCFHYMVAQEAELSGRLKSSKGNGWNSGSSAGHF
TVPLKPLTMEKEMTIDIPATNAPGVRLQLKAKGCPEELAVRLGFDLCAEEKAFLSRRKQV
VAKALKKALQLDRDLQEDEVPIVGIMATGGGARAMTSLYGHLLALKKLGLLDCVTYFSGI
SGATWTMAQLYGDPEWSQKDLEGPIRHAREHLAKSKLEAFSPERLASYRRELELRAEEGH
PTTFVDLWALVLESMLHDQVMDQKLSGQRAALEQGQNPLPLYLSLNVKENNLETLDFKEW
VEFSPYEVGFLKYGAFVPSELFGSEFFMGQLMKRLPESRICFLEGIWSNIFSLNLLDAWY
DLTSSSDTWRQHIKDKIRNLEDPPASLKTSSWLEALWLQPGTALAQAFKGFLTGRLLYQH
SSNFLQGLQLHQDYCNQKAFSTWADSQLDSTPGQLTPQEPQLCLVDAGYFLNTSYPSMFR
PGRRLDLILSFDYSLSSPFEMLQQTEVYCRGLGLPFPHVEPSPQDQRQPKECHLFSDPTC
PDAPVLLHFPLVNASFKDHSAPGVQRDPTELLAGQVDLTGATSPYSLFNMTYKEEDFDRL
LQLSDYNVRKSQDAILQALRTVLKHQAPAARLPGAQS
NT seq 2454 nt   +upstreamnt  +downstreamnt
atggagagactgacacctagggaaccacctggccatcctcatcagagggaggcttctgcc
tgctggcggctcactgtgagggtcctggaggctcgaggcctgggctggaccgacgtgttg
agcgaggcagacccctatgtggtcttacagatgccaactgcacctggaataaagtttaag
accaaaacagtcaccaactccagtcatcccgtatggaacgagagcttcagtttcctaatc
cagagacaggttaagaacgttctggagctgagcgtctatgatgaggactcagtcacggag
gatgacgcctgcttcaagtttctctatgacatctcagaagtcctccctggcaagctgctc
cggaagaccttctccctgcgcccccagggacaggaggaactggatgtggagttcctgatg
gaaaaaacgtcagaccgcccagaaaacctcatcaccaacaacgtccttgtggctcgagag
ctgtcatgcctggacattcgtctggagagcatggggagcacagccgtggtctcaaatcag
gagaacctggagctggagctggtgctgaaggggtcatatgaggacacacagacatctgcc
ctgggcacagcctctgctttctgctttcactacatggtggctcaagaggcagagctgagt
ggacgcctgaagagctctaaaggcaatggctggaactcaggcagctcagctgggcacttc
actgtgcctctgaagcccctcactatggagaaggagatgaccattgacattcctgctaca
aatgccccaggagtgaggttacagctcaaggctaagggctgcccagaggagctggccgtg
cgcctgggcttcgatctgtgtgcggaggagaaagctttcctgagcagaaggaagcaggtg
gtggccaaggccctgaagaaggccttgcagttggacagagacctacaggaagatgaggtc
cccatcgtagggatcatggccacaggaggaggtgccagggccatgacctctctctatggc
catctgttggctctgaaaaagctgggactcctggactgtgtgacgtacttcagcggcatc
tcgggagctacatggacaatggcccaactatatggggaccctgaatggtcacagaaggac
ctcgagggacccatccgacatgcccgagagcacctggccaagagcaagctagaagccttc
tccccagagagactggcaagctaccgcagggagctggagctgcgagcggaggaggggcac
cccaccacctttgtggacctgtgggctcttgtgctggagtccatgctgcacgaccaggtg
atggaccagaagctgtcaggacagagagccgcactggagcagggccagaaccctctgccc
ctctacttgagcctcaatgtcaaagagaacaacctggagactcttgatttcaaggagtgg
gtcgagttctccccctatgaggtgggattcctgaagtatggagcctttgtcccttctgag
ctcttcggctctgagttcttcatggggcagctgatgaagaggctccctgagtcccggatc
tgcttcctggaaggcatctggagcaacattttctccctgaatttgctggacgcctggtat
gacctcaccagttctagtgatacctggaggcagcacatcaaggacaaaatcaggaacctg
gaggacccccctgcctccttgaagacctcctcatggttggaggccttgtggctgcagcca
ggaacggcgctggcccaggcatttaagggcttcctgacaggcagactgctctaccagcac
agttccaacttcctccagggcctccagctgcaccaggactactgtaaccagaaggctttc
tctacctgggcagacagccagctagactccacccctggccagctgaccccacaggagccc
caactctgcctggtggatgccggctacttcctcaataccagctatccctctatgttccgg
ccaggccgcaggctggacctcatactctccttcgactactctctatcctcaccttttgag
atgctacagcagactgaggtgtactgccgaggcctggggctgccattcccccacgtggag
cccagcccacaggaccagcgccagcccaaggagtgtcacctcttctcagaccccacctgc
cctgatgcgcctgttctgctacacttcccgttggtcaacgcctcctttaaggaccactca
gccccaggtgtccagcgcgaccctacagagctactggccggccaggtggatctcactggg
gccacctcaccctactccttgttcaacatgacctacaaggaggaagactttgaccgcctg
ctgcaactgagtgattacaatgttcggaagagccaggacgccatcctgcaggccttgagg
acagttctgaagcaccaggccccagcggccaggcttccaggggcacagtcttga

KEGG   Miniopterus natalensis: 107536549
Entry
107536549         CDS       T05883                                 

Gene name
PLA2G4F
Definition
(RefSeq) cytosolic phospholipase A2 zeta
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
mna  Miniopterus natalensis
Pathway
mna00564  Glycerophospholipid metabolism
mna00565  Ether lipid metabolism
mna00590  Arachidonic acid metabolism
mna00591  Linoleic acid metabolism
mna00592  alpha-Linolenic acid metabolism
mna01100  Metabolic pathways
mna04010  MAPK signaling pathway
mna04014  Ras signaling pathway
mna04072  Phospholipase D signaling pathway
mna04217  Necroptosis
mna04270  Vascular smooth muscle contraction
mna04370  VEGF signaling pathway
mna04611  Platelet activation
mna04664  Fc epsilon RI signaling pathway
mna04666  Fc gamma R-mediated phagocytosis
mna04724  Glutamatergic synapse
mna04726  Serotonergic synapse
mna04730  Long-term depression
mna04750  Inflammatory mediator regulation of TRP channels
mna04912  GnRH signaling pathway
mna04913  Ovarian steroidogenesis
mna04921  Oxytocin signaling pathway
mna05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107536549 (PLA2G4F)
   00565 Ether lipid metabolism
    107536549 (PLA2G4F)
   00590 Arachidonic acid metabolism
    107536549 (PLA2G4F)
   00591 Linoleic acid metabolism
    107536549 (PLA2G4F)
   00592 alpha-Linolenic acid metabolism
    107536549 (PLA2G4F)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107536549 (PLA2G4F)
   04014 Ras signaling pathway
    107536549 (PLA2G4F)
   04370 VEGF signaling pathway
    107536549 (PLA2G4F)
   04072 Phospholipase D signaling pathway
    107536549 (PLA2G4F)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107536549 (PLA2G4F)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107536549 (PLA2G4F)
   04664 Fc epsilon RI signaling pathway
    107536549 (PLA2G4F)
   04666 Fc gamma R-mediated phagocytosis
    107536549 (PLA2G4F)
  09152 Endocrine system
   04912 GnRH signaling pathway
    107536549 (PLA2G4F)
   04913 Ovarian steroidogenesis
    107536549 (PLA2G4F)
   04921 Oxytocin signaling pathway
    107536549 (PLA2G4F)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107536549 (PLA2G4F)
  09156 Nervous system
   04724 Glutamatergic synapse
    107536549 (PLA2G4F)
   04726 Serotonergic synapse
    107536549 (PLA2G4F)
   04730 Long-term depression
    107536549 (PLA2G4F)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107536549 (PLA2G4F)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    107536549 (PLA2G4F)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     107536549 (PLA2G4F)
SSDB
Motif
Pfam: PLA2_B cPLA2_C2 C2
Other DBs
NCBI-GeneID: 107536549
NCBI-ProteinID: XP_016067788
LinkDB
Position
Unknown
AA seq 849 aa
MHWALWPQWLTSKGLPLLGVVLLRKREKRAPEWSHCRRETHPYYDLQVKVLRARNIQGKD
LLSKADCYVQLWLPTASPSHAQTRVIDNCSDPEWNETFHYQIHGAVKNVLELTLYDKDVL
GSNELSLLLFDLKSLKPGQPHKHTFLLNQQDSQELQVEFVLEKSQVPASEVITNGVLVAQ
PCLKIQGTLGGDETALHPKYGSRQVRLAVPGAYEKAQLLPLQPPLEGYPPDTFAFHVNPV
LRSRLLMEVGEKLTILQSDPSAELEAQTNNLGEGGILLSSLALGQEEQCLVAVGKGQEVS
LNVKAEMSSGDLDLRLGFDLCDGEREFLDKRKQIVSKALQQVLGLSQSPDSGQVPVVAVL
GSGGGTRAMSSLYGSLAGLQELRLLDTVTYLGGVSGSTWCISTLYMDPSWSQVALQGPTE
RAQARVCSSKKGAVSTERLQYYAEELKNLESSNHSVSLIDLWGLIMEYFLYQEENPAKLS
DQQEAVSQSQNPYPIYASVNVRTNISGEDFAEWCEFTPHEVGFPKYGAYVPTKLFGSEFF
MGRLLKPWPEPRICYLQGVWGSAFAASLDEIFQKTAGFNLGFLDWHRGSVKVTGEDNQQR
LQDPTRLRTRLFTPQGPFSQAVLDIFTSRFTSAENFNFTRGLCLHKDYVAGREFVAWKDT
HPDAFPNQLTPMRDSLCLLDGGFAINSPFPLILLPQREVDLIVSFDYSLDAPFEVLQMTE
KYCQDRGIPFPRIEVLPEDLEEPGECYLFARAEDPGAPIVLHFPLVNGTFRTHLAPGVER
QTAEEKAFGDFDVNGPDTPYGMMNFTYEPEEFDRLVALSRYNVLNNVETIKKALQLALDR
RQAVGRAGS
NT seq 2550 nt   +upstreamnt  +downstreamnt
atgcactgggcgctctggccacagtggctgacaagcaaggggctgcccctactgggggta
gtgttgctgcgaaagagagagaagagggcacctgaatggagtcactgccggcgggaaacc
cacccatactatgacctccaggtgaaggtgctgagggccaggaatatccagggcaaagac
ctgttgtccaaagctgactgctatgtgcaactgtggctgcccacagcatctcccagccat
gcccagacaagagtgatagacaactgcagtgaccctgagtggaatgagaccttccactac
cagatccatggtgctgtgaagaatgtcctggagctcaccctctatgacaaggacgtcctg
ggcagcaatgaactctccctgctgctgtttgacctgaagagcctcaagcctggccaaccc
cacaaacacactttcctactcaaccaacaggattcacaagagctacaggtggaatttgtt
ctggagaagagccaggtgcctgcatctgaagtcatcaccaatggtgtcctggtggctcag
ccctgtctgaaaatccagggcaccctagggggagacgagacagctctacatccaaagtat
ggctctaggcaagttcgtctggcagtgcctggggcctacgagaaagcacagctcttgccc
ctgcagcctcccttggagggctaccccccagacacctttgccttccacgtgaatccagtc
cttcgctctaggctgctcatggaggttggagagaagctcacgatcctgcagagcgacccg
agtgctgagctggaggctcagaccaacaatctgggtgaggggggcatcctgctctcctcc
ctggccctaggtcaggaggaacagtgcttggtggctgtggggaagggccaggaggtgtct
ctgaatgtaaaggcagaaatgagctctggggaccttgacttgcgccttggctttgacctc
tgtgacggggaacgagagtttctggacaagaggaagcagatcgtatccaaggccctgcag
caggtgctgggattgagccagtctcccgacagtggccaggtgcctgtggtggctgtgctg
ggctctggaggtggaacccgtgccatgtcttccctatacggcagcctagcagggctgcag
gagctccgtctcctggacactgtgacctacctgggtggggtgtcggggtctacctggtgc
atctccacactctacatggacccatcttggtcccaggtggccttgcagggccccactgag
cgagcccaggctcgggtctgcagcagcaagaagggggcagtgtccacggagcgcctacaa
tactatgccgaggaactgaagaacctggaaagcagcaatcacagcgtttcccttattgac
ctctggggcctcatcatggagtatttcctgtaccaggaggaaaacccagccaagctctct
gaccagcaggaggcagtcagccagagccagaacccttatcccatctatgccagtgtcaac
gtccgcaccaacatcagcggggaagactttgcagagtggtgcgagtttaccccccacgag
gtcggcttccccaagtatggagcttatgttcccaccaagctcttcggctcagagttcttc
atggggcgattgctgaagccctggccagagccccgaatctgctacctgcagggtgtatgg
ggcagtgcctttgcagccagcctggatgagatcttccagaagaccgccggctttaacctt
ggcttcctggactggcaccgtggcagcgtgaaggtcacaggtgaggataaccaacagagg
cttcaggaccccacgaggctgcgaacgagactcttcaccccccaggggcccttctctcag
gctgtgctagacatattcacctcccgcttcacctctgcggagaactttaacttcacccgt
ggcctctgtctgcacaaggactatgtggctggcagggagtttgtggcctggaaagacaca
cacccagacgccttccccaaccagctcactcccatgcgggactccctgtgcctgttggat
gggggctttgccatcaactctccattcccgctgatcctgctgccgcagagagaggtggac
ctcattgtgtcctttgactactccctggatgctccttttgaggtcttacagatgacagag
aagtactgccaggaccgcggcatccccttccccagaatcgaggtgctccctgaggacctg
gaggagcctggcgagtgctacctgtttgccagggcagaggaccccggtgcacccattgtg
ctgcacttcccccttgtcaacggtaccttccgcacacacttggctccaggtgtggagcga
caaacagctgaggagaaggcctttggggactttgacgtcaatgggccagacaccccctat
ggcatgatgaacttcacctatgagccggaggagtttgatcggctggtggccctgagccga
tacaatgttctgaacaacgtggagaccattaagaaggccctccagctggccctggaccga
cggcaggctgtgggcagggctggaagctga

KEGG   Miniopterus natalensis: 107536550
Entry
107536550         CDS       T05883                                 

Gene name
PLA2G4E
Definition
(RefSeq) cytosolic phospholipase A2 epsilon
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
mna  Miniopterus natalensis
Pathway
mna00564  Glycerophospholipid metabolism
mna00565  Ether lipid metabolism
mna00590  Arachidonic acid metabolism
mna00591  Linoleic acid metabolism
mna00592  alpha-Linolenic acid metabolism
mna01100  Metabolic pathways
mna04010  MAPK signaling pathway
mna04014  Ras signaling pathway
mna04072  Phospholipase D signaling pathway
mna04217  Necroptosis
mna04270  Vascular smooth muscle contraction
mna04370  VEGF signaling pathway
mna04611  Platelet activation
mna04664  Fc epsilon RI signaling pathway
mna04666  Fc gamma R-mediated phagocytosis
mna04724  Glutamatergic synapse
mna04726  Serotonergic synapse
mna04730  Long-term depression
mna04750  Inflammatory mediator regulation of TRP channels
mna04912  GnRH signaling pathway
mna04913  Ovarian steroidogenesis
mna04921  Oxytocin signaling pathway
mna05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107536550 (PLA2G4E)
   00565 Ether lipid metabolism
    107536550 (PLA2G4E)
   00590 Arachidonic acid metabolism
    107536550 (PLA2G4E)
   00591 Linoleic acid metabolism
    107536550 (PLA2G4E)
   00592 alpha-Linolenic acid metabolism
    107536550 (PLA2G4E)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107536550 (PLA2G4E)
   04014 Ras signaling pathway
    107536550 (PLA2G4E)
   04370 VEGF signaling pathway
    107536550 (PLA2G4E)
   04072 Phospholipase D signaling pathway
    107536550 (PLA2G4E)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107536550 (PLA2G4E)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107536550 (PLA2G4E)
   04664 Fc epsilon RI signaling pathway
    107536550 (PLA2G4E)
   04666 Fc gamma R-mediated phagocytosis
    107536550 (PLA2G4E)
  09152 Endocrine system
   04912 GnRH signaling pathway
    107536550 (PLA2G4E)
   04913 Ovarian steroidogenesis
    107536550 (PLA2G4E)
   04921 Oxytocin signaling pathway
    107536550 (PLA2G4E)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107536550 (PLA2G4E)
  09156 Nervous system
   04724 Glutamatergic synapse
    107536550 (PLA2G4E)
   04726 Serotonergic synapse
    107536550 (PLA2G4E)
   04730 Long-term depression
    107536550 (PLA2G4E)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107536550 (PLA2G4E)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    107536550 (PLA2G4E)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     107536550 (PLA2G4E)
SSDB
Motif
Pfam: cPLA2_C2 PLA2_B C2
Other DBs
NCBI-GeneID: 107536550
NCBI-ProteinID: XP_016067789
LinkDB
Position
Unknown
AA seq 864 aa
MTLQALEGHPGLGADVLVSQSLQGDEEDSRSGRNVSEFEHTQDLETPDFPPLLPMAPWGS
QEGLSPCYLLTVRVIRMKNVRQADRLSQTDCYVSLWLPTASHEKLRTRTISNCPNPEWNE
SFNFQIQSQVKNVLELSVCDEDTVTPDDHLLTVLYDLKKLCFRKKTHVKFPLNPEGMEEL
EVEFLLEESPSPPETLITNGVLVARQVSCLEVHAESRRQRKNRKRKDLLVTVTESFEHTQ
RIPQSLESCCPNLAYFHYPKYFQSRMHVDMARSQGSCGLCCCGSHKRNNVVNQPLDCITD
GQAVTLPAGENCELHVKSTPCPQTLDVRLGYSLCQEELEFLEKRKVVVAKALKQVLQLEE
DLQMDEVPLITIMATGGGTRSMTAMYGHLLGLQKLNLLNCASHITGLSGATWTMATLYRD
PDWSSKNLEPAILEARRHVVKDKMPALFPDQLRKFREELRQRSQEGYKVNFTDFWGLLIE
ACLGDERNECKLSEQRAALSQGQNPLPIYLTINVKDDVSNQDFREWCEFSPYEVGMQKYG
AFVPTELFGSEFFMGRLMRRIPESRMCYLLGLWSSIFSVNLLDAWNFARSSEEFFHRWTR
EKVQDIEDEPLLPEIPKCDANALETSVVIPGSWLSNTFRHILTYRSFVSEFHNFLLGLQL
HTNYLQNGQFSKWKDTVLDSFPNQLTQSVNHLCLLDTAFFVNSSYPPLLRPERKADLIIH
LNYCAGSQTKPMKQTCEYCSVQNIPFPNYDIQEEGNNNLKECYLMKNSEEPDAPIVLFFP
LISDTFQKYKAPGVERSPEELEKGQVDIYGPKTPYATKELTYTEAAFDKLVNLCEYNILN
NKDQLLQALRMAVEKKKLLKNQCP
NT seq 2595 nt   +upstreamnt  +downstreamnt
atgactctccaggccttggaaggccatcctggcctaggagctgatgtgcttgtctcacag
agcctacaaggggatgaagaagacagcaggtctggaagaaatgtcagtgagtttgagcat
acacaggacctggaaactcctgatttcccacctctccttcctatggccccgtggggctct
caggaggggctatctccatgctacctgctaaccgtgagggtcattcggatgaaaaacgtc
cggcaggctgacaggctgagccagacggactgctatgtgagcctctggctgcccaccgct
tctcatgagaagctgaggactagaaccatctccaactgcccaaacccagagtggaatgaa
agcttcaacttccagatccagagccaagtgaagaatgtgctagagctgagcgtctgcgat
gaagacacagtgacaccagatgaccatcttttgacagttctctatgacctcaaaaagctc
tgcttcaggaagaaaacccatgtgaagttcccactcaatccagagggcatggaggagctg
gaggtggagttcctgctggaggagagtccctctccacctgagaccctcatcaccaatggc
gtgctggtggctcgacaagtctcctgcctggaggttcatgcagaatccagaaggcagagg
aagaataggaaaaggaaggacctcctggtaacagtgacagagtccttcgagcacacccag
cgcatcccacagagcctggagtcctgctgcccaaaccttgcctacttccactaccccaag
tatttccagtcccggatgcacgtagacatggccagaagccaagggagctgtgggctttgc
tgctgcggctcgcacaagaggaacaacgttgtcaaccagcccctggattgcatcactgat
ggccaggcggtgaccctgcctgcgggagagaactgtgaattacacgtgaagtctacaccc
tgtccccagacgttggacgtgcggctgggctacagcctgtgccaggaagagctggagttc
ctggagaagcggaaggtggtggtggccaaggctctgaagcaggtgttgcagctggaggag
gacctgcagatggacgaggtgccgctcatcaccatcatggccactgggggtggaacaaga
tccatgaccgccatgtacggccacctgctggggctgcagaagctgaacctcctgaactgt
gccagccacatcactggcctgtcaggggccacctggaccatggcaaccttataccgtgat
cctgactggtcctccaaaaacctggagcctgccatccttgaggcccggaggcacgtggtc
aaggacaagatgcctgccctgttcccagaccagctccgcaaattccgggaggagctccgg
cagcgcagtcaggaaggctacaaggtcaactttacagacttctggggcctactgatcgag
gcctgtctgggggacgaaagaaatgaatgcaaactgtcagagcagcgtgctgctttgagc
cagggccagaaccccctgcccatctacctcaccatcaatgtcaaggacgatgtaagcaac
caggatttcagagagtggtgcgagttttccccgtacgaggtgggcatgcagaagtatggg
gccttcgtccccaccgagctcttcggttccgagttcttcatgggacggctgatgcggagg
atcccagagtctcggatgtgctacctgctaggtttatggagcagcatcttctctgtgaac
ctgctcgatgcctggaattttgcccgatcttcagaagagttttttcacaggtggacaagg
gagaaagtacaagacattgaagatgagccgctccttcctgaaatccccaaatgtgatgcc
aacgccctggagacctcggtggtgatcccagggtcatggctctccaatactttccgccac
atcctcacttaccgctcgtttgtgtctgagttccacaacttcctgctggggctgcagctg
cacaccaactacctccagaatggccagttctccaagtggaaagacactgtgcttgacagc
ttcccgaaccagctgacacagtccgtgaaccacttgtgtctgctggacactgcgttcttt
gtcaactccagctacccacccctcctcaggccggagaggaaagctgacctcatcatccac
ctcaattattgtgcagggtcccagacaaagccaatgaaacaaacctgtgagtactgctct
gtgcagaacatccccttccccaactatgacatccaagaggaggggaataacaatctcaag
gaatgctacctgatgaagaactccgaggagcctgatgcccccattgtgcttttcttccca
ctcatcagtgacaccttccaaaagtacaaggccccaggtgtggagcgaagccccgaggag
ctggagaagggccaggttgacatttatggccccaaaactccctatgccaccaaggagctg
acatacacggaggctgccttcgacaagttggtgaacctctgcgagtacaacatcctgaat
aacaaagaccagctccttcaggccctgaggatggcagtggagaagaagaaactcctgaag
aaccagtgtccctag

KEGG   Miniopterus natalensis: 107536561
Entry
107536561         CDS       T05883                                 

Definition
(RefSeq) cytosolic phospholipase A2 beta isoform X1
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
mna  Miniopterus natalensis
Pathway
mna00564  Glycerophospholipid metabolism
mna00565  Ether lipid metabolism
mna00590  Arachidonic acid metabolism
mna00591  Linoleic acid metabolism
mna00592  alpha-Linolenic acid metabolism
mna01100  Metabolic pathways
mna04010  MAPK signaling pathway
mna04014  Ras signaling pathway
mna04072  Phospholipase D signaling pathway
mna04217  Necroptosis
mna04270  Vascular smooth muscle contraction
mna04370  VEGF signaling pathway
mna04611  Platelet activation
mna04664  Fc epsilon RI signaling pathway
mna04666  Fc gamma R-mediated phagocytosis
mna04724  Glutamatergic synapse
mna04726  Serotonergic synapse
mna04730  Long-term depression
mna04750  Inflammatory mediator regulation of TRP channels
mna04912  GnRH signaling pathway
mna04913  Ovarian steroidogenesis
mna04921  Oxytocin signaling pathway
mna05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107536561
   00565 Ether lipid metabolism
    107536561
   00590 Arachidonic acid metabolism
    107536561
   00591 Linoleic acid metabolism
    107536561
   00592 alpha-Linolenic acid metabolism
    107536561
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107536561
   04014 Ras signaling pathway
    107536561
   04370 VEGF signaling pathway
    107536561
   04072 Phospholipase D signaling pathway
    107536561
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107536561
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107536561
   04664 Fc epsilon RI signaling pathway
    107536561
   04666 Fc gamma R-mediated phagocytosis
    107536561
  09152 Endocrine system
   04912 GnRH signaling pathway
    107536561
   04913 Ovarian steroidogenesis
    107536561
   04921 Oxytocin signaling pathway
    107536561
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107536561
  09156 Nervous system
   04724 Glutamatergic synapse
    107536561
   04726 Serotonergic synapse
    107536561
   04730 Long-term depression
    107536561
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107536561
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    107536561
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     107536561
SSDB
Motif
Pfam: Cupin_8 PLA2_B cPLA2_C2 C2
Other DBs
NCBI-GeneID: 107536561
NCBI-ProteinID: XP_016067821
LinkDB
Position
Unknown
AA seq 1014 aa
MAEVALEAVRRELREFPAAVRELSVPLAVPYLDKPPTPLRFYRDWVCPNRPCIIRNALKH
WPALQKWSLPYLRTTVGSTEVSVAVTPDGYADAVRGDRFVMPAERRLPLSCVLDVLEGRA
QHPGVLYVQKQCSNLPTELPQLLPDLEPHVPWASEALGKMPDAVNFWLGEAAAVTSLHKD
HYENLYCVVSGEKHFLLHPPSDRPFIPYEMYTPATYQLTEEGFFKMVDEEAMEKAKVPGT
CLLTIRVLQARGLPSKDLVTPSDCYVTLWLPTASSHRLQTRTVKNSRNPIWNQSFRFRIH
NQLKNVVQLQVFDQDLLTSDDPVLSVLYDVGTLRIGEFRRESFPQSPQGEEQLEVEFRLQ
SLTDCAEQLVSNGILVGRELSCLHVRLEEAGDQNGSEGRVQLVVPGSCEGPQEASVGTAS
CFHCPACWEQELSVHLQDAPQEQLKVPLRVLPFGQVVRLVFPTSQEPLMRVELKKEEGPK
ELAVRLGCGPCAEEHAFLSRRKQVVAKALKQALQLDGDLQEDEIPVVAVMATGGGIRAMT
SLFGQLAGLRELGLLDCISYITGASGSTWALANLYEDPEWSQKDLAGPTKLLKTQVTKSK
LGVLAPSQLQRYRQELAERARLGYPTCFTNLWALINEALLHDEPHDHKLSDQREALSRGQ
NPLPIYCALNTKEKNLTTFEFAEWCEFSPYEVGFPKYGAFIPSELFGSEFFMGRLMKRLP
ESRICFLEGIWSNLYAANLQDSLYWASEPRQFWDRWAQDQANLDKEQVPLLKIEEPPTVA
GRIAEFFTDLLTRRPLSQATHNFLYGLHFHKDYFQHPHFSTWKATKLDGLPNQLTPAEPY
LCLLDVGYFINTSCLPLLRPTRDVDLILSLDYNLHGAFQQLQLLGRFCQEQGIPFPPISP
SPEEQRQPQECHLFLDPDCPEAPAVLHFPLVNNSFREHSAPGVRRTAEEAAAGEVNLSSS
NSPYHYSKVTYSQEDVDKLLHLTHYNICNNRERLLEALREAVRRRRQRKQRQPQ
NT seq 3045 nt   +upstreamnt  +downstreamnt
atggcggaggtggctttggaagccgtgcggagggagttacgagaattccctgcggcggta
agggagctcagcgtgcctcttgctgtgccttacctggacaagcccccaactccgcttcgc
ttctaccgggactgggtctgccccaaccggccgtgtatcatccgcaatgccctgaagcat
tggccagccctccagaagtggtctctcccttacctcagaaccacagtgggctccacggag
gtgagtgtggctgttaccccagatggttatgcggatgctgtacgaggggaccgctttgtg
atgcccgctgagcgccgcctgcccctgagctgtgtgctggacgtgctagagggccgagcc
caacacccaggcgtcctctacgtgcagaagcagtgctccaacctgcccactgagctgccc
cagctgctgcctgatctggagccccatgttccctgggcctctgaggctctgggaaagatg
cctgatgctgtgaacttctggctgggggaggcggctgcagtgacatctttgcataaggac
cactacgagaacctctactgtgtggtctcgggagagaaacactttctgctacatccaccc
agtgaccggcccttcatcccctatgagatgtacactccagcaacctaccaactaactgaa
gagggcttctttaaaatggtggatgaggaggccatggagaaggcaaaggtgcctgggacc
tgcctgctcaccattcgtgtcctacaggcccgtggcctgccttccaaggatctagtgacc
ccctctgactgctatgtgactctgtggctgcccacggcctccagccacaggctccagaca
cgcacagttaagaacagcagaaaccccatctggaatcagagctttcgcttccggatccac
aaccagctcaagaatgtcgtacaactgcaagtctttgaccaggatcttttgaccagtgac
gaccccgtgttgtcggtgctgtatgacgtggggactttgcggattggggaattccgccgg
gaaagcttcccccagagccctcagggtgaggagcagctggaagttgaatttcgactgcag
agtctgacagactgtgctgagcagcttgttagcaatggcatcctggtgggccgggagctc
tcctgcttacatgttcgactggaggaggccggggaccagaatgggtcagaaggcagagtt
cagcttgtggttcctgggtcctgtgagggtccacaggaggcctcagtgggcactgcctcc
tgcttccattgcccggcctgctgggagcaggagctgagtgttcacctgcaggatgccccc
caggagcaactgaaggtgcccctgagggtcctgccctttggccaggtggtgagactcgtc
ttccctacgtcccaggagcctctgatgagggtggagctgaaaaaagaagaaggaccaaag
gagctggctgtgcggctgggctgtgggccctgtgctgaggagcatgccttcctgagcagg
aggaagcaggtggtggccaaggccctgaagcaggccctgcagctggatggagacctgcag
gaggatgagatcccagtggtagctgttatggccactggaggtgggatccgagccatgact
tccctgtttgggcagctggcaggtctgagggagctgggcctcttggattgcatctcctat
atcacaggggcctcgggatccacctgggctttggccaacctctacgaggacccagagtgg
tctcaaaaggacctggcagggcccaccaagttgctgaagacccaggtgaccaagagcaag
ctgggtgtgttggcccccagtcagctgcagcggtatcggcaggagctggccgagcgtgcc
cgcctgggctacccgacctgcttcaccaacctgtgggccctcatcaacgaggcactgctg
catgatgagccccatgatcacaaactctcagaccagcgggaggccctgagtcgaggccag
aatcctctgcccatctactgtgccctcaacaccaaggagaagaacctgactacctttgaa
tttgcagagtggtgcgaattctccccctatgaggtcggctttcccaagtacggcgccttc
atcccgtctgagctctttggctctgagttcttcatggggcgactgatgaagcggcttcct
gagtctcgaatctgcttcctggaaggcatctggagcaacctgtatgcagctaacctccag
gacagcttatactgggcctcagagccccgccagttctgggaccgctgggcacaggatcag
gccaacctggacaaggagcaggtcccccttctgaagatagaagagcctcccactgtggct
ggcaggatcgctgagtttttcactgaccttctgacgcggcgcccactttcccaggccacc
cacaatttcctatatggcctccatttccataaagactatttccagcatcctcacttctcc
acctggaaagccaccaaactggacgggctccccaaccagctgacacctgcagagccctac
ctttgcctactggatgttggctactttatcaacaccagctgccttcccctcctgcggccc
acaagggatgtggacctcatcctgtcgctggattacaacctccatggagcctttcagcag
ctgcagcttctgggccgattctgccaggagcaggggatcccattcccacccatctcgccc
agccctgaggagcagcgccagccgcaggaatgccacctgttcttggaccccgactgccct
gaagcccctgctgtgctgcacttccccctggtcaacaactccttccgggagcactcagcc
cctggggtccgccggacagctgaggaggcggcggctggggaggtgaacttgtcttcatcc
aactccccctatcactactcgaaggtgacctatagccaggaagatgtggacaagctgctc
cacctgactcattataacatctgcaacaaccgggagcggctgctggaggccctgcgtgag
gctgtgcggcggcggaggcaacgcaagcagcgccagccccagtga

KEGG   Miniopterus natalensis: 107538317
Entry
107538317         CDS       T05883                                 

Gene name
PLA2G2A
Definition
(RefSeq) phospholipase A2, membrane associated
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
mna  Miniopterus natalensis
Pathway
mna00564  Glycerophospholipid metabolism
mna00565  Ether lipid metabolism
mna00590  Arachidonic acid metabolism
mna00591  Linoleic acid metabolism
mna00592  alpha-Linolenic acid metabolism
mna01100  Metabolic pathways
mna04014  Ras signaling pathway
mna04270  Vascular smooth muscle contraction
mna04972  Pancreatic secretion
mna04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107538317 (PLA2G2A)
   00565 Ether lipid metabolism
    107538317 (PLA2G2A)
   00590 Arachidonic acid metabolism
    107538317 (PLA2G2A)
   00591 Linoleic acid metabolism
    107538317 (PLA2G2A)
   00592 alpha-Linolenic acid metabolism
    107538317 (PLA2G2A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107538317 (PLA2G2A)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107538317 (PLA2G2A)
  09154 Digestive system
   04972 Pancreatic secretion
    107538317 (PLA2G2A)
   04975 Fat digestion and absorption
    107538317 (PLA2G2A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107538317 (PLA2G2A)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     107538317 (PLA2G2A)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    107538317 (PLA2G2A)
SSDB
Motif
Pfam: Phospholip_A2_1
Other DBs
NCBI-GeneID: 107538317
NCBI-ProteinID: XP_016070016
LinkDB
Position
Unknown
AA seq 144 aa
MKTLLLLALIMAFGLLQTQGSLWDFQKMIRQVTGKGAASSYGFYGCYCGLGGRGSPKDAT
DRCCAAHDCCYKRLQKRGCGTKALGYSFTYRKGQVICGKQGSCQSQLCQCDKTAASCFKR
NLKTYNKKYQFYNNKQCKGNAYRC
NT seq 435 nt   +upstreamnt  +downstreamnt
atgaagacccttctgttgttggccttgatcatggcctttggcctgctgcagacccaaggg
agtttgtgggatttccagaaaatgatacggcaagtgacaggaaagggagctgcatccagt
tacggcttctatggttgctactgtggccttggcggccgaggatcccccaaggatgcgacg
gatcggtgctgcgccgcacatgactgttgctacaaacggctgcagaagcggggctgtggc
accaaggccctaggctacagctttacttaccgcaagggccaagtcatctgtgggaaacag
ggctcctgtcagagtcaactgtgtcaatgtgataaaacagctgcctcctgttttaaaaga
aacctgaagacctacaataagaaataccaattctacaacaacaagcagtgcaaagggaat
gcctaccggtgctga

KEGG   Miniopterus natalensis: 107538382
Entry
107538382         CDS       T05883                                 

Gene name
PLA2G2E
Definition
(RefSeq) group IIE secretory phospholipase A2
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
mna  Miniopterus natalensis
Pathway
mna00564  Glycerophospholipid metabolism
mna00565  Ether lipid metabolism
mna00590  Arachidonic acid metabolism
mna00591  Linoleic acid metabolism
mna00592  alpha-Linolenic acid metabolism
mna01100  Metabolic pathways
mna04014  Ras signaling pathway
mna04270  Vascular smooth muscle contraction
mna04972  Pancreatic secretion
mna04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107538382 (PLA2G2E)
   00565 Ether lipid metabolism
    107538382 (PLA2G2E)
   00590 Arachidonic acid metabolism
    107538382 (PLA2G2E)
   00591 Linoleic acid metabolism
    107538382 (PLA2G2E)
   00592 alpha-Linolenic acid metabolism
    107538382 (PLA2G2E)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107538382 (PLA2G2E)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107538382 (PLA2G2E)
  09154 Digestive system
   04972 Pancreatic secretion
    107538382 (PLA2G2E)
   04975 Fat digestion and absorption
    107538382 (PLA2G2E)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107538382 (PLA2G2E)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     107538382 (PLA2G2E)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    107538382 (PLA2G2E)
SSDB
Motif
Pfam: Phospholip_A2_1
Other DBs
NCBI-GeneID: 107538382
NCBI-ProteinID: XP_016070073
LinkDB
Position
Unknown
AA seq 142 aa
MKPPLLLTILCLLVAVAGGNLVQFGVMIEKVTGKSALQYNDYGCYCGIGGSHWPVDQTDW
CCHAHDCCYGRLQKLGCEPKLERYLFSTSRSNVLCGGRTACQRQTCECDKTAALCFRQNL
DTYDRKYAHYPNKLCRGPTPPC
NT seq 429 nt   +upstreamnt  +downstreamnt
atgaagcctccccttcttctaacaatcctttgcctcctggtggccgtggccggcgggaac
ctggtccagtttggggtgatgattgagaaggtgacagggaagtcagcactgcagtacaat
gactatggctgctactgtggcattggcggctcccactggccagtggaccagacggactgg
tgctgccatgcccacgactgctgctatgggcgtctgcagaagctgggctgtgaacccaag
ctggagaggtatcttttctccaccagccggagcaacgtcctctgtgggggcagaactgcc
tgccagcgacagacctgcgagtgtgacaagacggctgcactctgctttcgtcaaaacctg
gacacctatgaccgcaaatacgcccactaccccaataagctgtgcagaggccccactccg
ccctgctaa

KEGG   Miniopterus natalensis: 107538385
Entry
107538385         CDS       T05883                                 

Gene name
PLA2G2C
Definition
(RefSeq) putative inactive group IIC secretory phospholipase A2
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
mna  Miniopterus natalensis
Pathway
mna00564  Glycerophospholipid metabolism
mna00565  Ether lipid metabolism
mna00590  Arachidonic acid metabolism
mna00591  Linoleic acid metabolism
mna00592  alpha-Linolenic acid metabolism
mna01100  Metabolic pathways
mna04014  Ras signaling pathway
mna04270  Vascular smooth muscle contraction
mna04972  Pancreatic secretion
mna04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107538385 (PLA2G2C)
   00565 Ether lipid metabolism
    107538385 (PLA2G2C)
   00590 Arachidonic acid metabolism
    107538385 (PLA2G2C)
   00591 Linoleic acid metabolism
    107538385 (PLA2G2C)
   00592 alpha-Linolenic acid metabolism
    107538385 (PLA2G2C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107538385 (PLA2G2C)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107538385 (PLA2G2C)
  09154 Digestive system
   04972 Pancreatic secretion
    107538385 (PLA2G2C)
   04975 Fat digestion and absorption
    107538385 (PLA2G2C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107538385 (PLA2G2C)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     107538385 (PLA2G2C)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    107538385 (PLA2G2C)
SSDB
Motif
Pfam: Phospholip_A2_1 Parvo_coat_N Phospholip_A2_2
Other DBs
NCBI-GeneID: 107538385
NCBI-ProteinID: XP_016070076
LinkDB
Position
Unknown
AA seq 150 aa
MKVIGVLVVFTSCSPAHSSFWQFQRMVKHITGRSAFFSYYGYGCYCGLGGKGTPVDDTDR
CCLAHDCCYEKLKQLGCQPLLSSYQFRIFNGTVVCECALGPSVGCLCGLRACECDKRSSY
CFKENLPTYEKNFKQFFLSRPRCGRRKVQC
NT seq 453 nt   +upstreamnt  +downstreamnt
atgaaggtcatcggggttctcgtggtcttcacctcctgctcccccgcccacagcagcttc
tggcagtttcaaaggatggtcaagcacatcacagggcggagtgccttcttctcatactat
ggatatggctgctactgtgggctcgggggcaaagggacccctgtggatgacactgacagg
tgctgcctggcccacgactgctgctacgagaagctgaagcagctgggctgccagcccttg
ctgagcagctaccagttccgcatcttcaatggcaccgtggtctgtgaatgtgcccttggt
cccagtgtaggctgcctctgtgggctgagggcctgcgagtgtgacaagcgatcttcatac
tgcttcaaagagaacctgcccacctacgagaaaaacttcaagcagttcttcctgagccgg
ccccggtgtggcaggcgtaaagtccagtgctag

KEGG   Miniopterus natalensis: 107538464
Entry
107538464         CDS       T05883                                 

Gene name
PLA2G2F
Definition
(RefSeq) group IIF secretory phospholipase A2
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
mna  Miniopterus natalensis
Pathway
mna00564  Glycerophospholipid metabolism
mna00565  Ether lipid metabolism
mna00590  Arachidonic acid metabolism
mna00591  Linoleic acid metabolism
mna00592  alpha-Linolenic acid metabolism
mna01100  Metabolic pathways
mna04014  Ras signaling pathway
mna04270  Vascular smooth muscle contraction
mna04972  Pancreatic secretion
mna04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107538464 (PLA2G2F)
   00565 Ether lipid metabolism
    107538464 (PLA2G2F)
   00590 Arachidonic acid metabolism
    107538464 (PLA2G2F)
   00591 Linoleic acid metabolism
    107538464 (PLA2G2F)
   00592 alpha-Linolenic acid metabolism
    107538464 (PLA2G2F)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107538464 (PLA2G2F)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107538464 (PLA2G2F)
  09154 Digestive system
   04972 Pancreatic secretion
    107538464 (PLA2G2F)
   04975 Fat digestion and absorption
    107538464 (PLA2G2F)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107538464 (PLA2G2F)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     107538464 (PLA2G2F)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    107538464 (PLA2G2F)
SSDB
Motif
Pfam: Phospholip_A2_1 Parvo_coat_N
Other DBs
NCBI-GeneID: 107538464
NCBI-ProteinID: XP_016070212
LinkDB
Position
Unknown
AA seq 208 aa
MADGAQVNPKGFRKKVLVRHPSGWRSPNLRASSLRASRCSPALKFLTIAILAGSILPAAH
SSLFNLKSMVEAITGKNAILSFVGYGCYCGLGGRGMPMDAVDWCCHAHDCCYQKLFDQGC
HTYVDHYEYSIENNTTIICRDLNQTDCDRQTCECDKGVALCFQKQTYNERHRNYLNIYCQ
GSTPNCSIYEQPREEACRPPSSPPTALP
NT seq 627 nt   +upstreamnt  +downstreamnt
atggcagatggggcgcaggtcaaccccaaagggttcaggaagaaggtgctggttagacat
ccctctgggtggaggagcccaaatctcagggcctcttctttgagggcctccagatgtagc
ccggctttgaagttcctcaccatcgccatcctggccggcagcatcctgcctgccgcacac
agcagcctgttcaacctgaagtccatggtggaagccatcacgggaaaaaatgccatcctg
tccttcgtgggctacggctgctactgtgggctgggggggcgaggcatgcccatggatgca
gtagactggtgctgccatgcccatgactgctgctaccagaagctctttgaccagggctgc
cacacctacgtggaccattatgagtactccatcgagaataatactacgattatctgcaga
gatctcaaccagacggactgcgacaggcagacctgtgagtgcgacaagggcgtggctctg
tgcttccagaagcagacatacaacgagaggcatcgcaactacctcaacatctactgccag
ggctccacccccaactgcagcatctatgagcaaccccgggaggaagcctgcaggcccccc
tcctcaccacccaccgcactgccctag

KEGG   Miniopterus natalensis: 107538466
Entry
107538466         CDS       T05883                                 

Gene name
PLA2G5
Definition
(RefSeq) calcium-dependent phospholipase A2
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
mna  Miniopterus natalensis
Pathway
mna00564  Glycerophospholipid metabolism
mna00565  Ether lipid metabolism
mna00590  Arachidonic acid metabolism
mna00591  Linoleic acid metabolism
mna00592  alpha-Linolenic acid metabolism
mna01100  Metabolic pathways
mna04014  Ras signaling pathway
mna04270  Vascular smooth muscle contraction
mna04972  Pancreatic secretion
mna04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107538466 (PLA2G5)
   00565 Ether lipid metabolism
    107538466 (PLA2G5)
   00590 Arachidonic acid metabolism
    107538466 (PLA2G5)
   00591 Linoleic acid metabolism
    107538466 (PLA2G5)
   00592 alpha-Linolenic acid metabolism
    107538466 (PLA2G5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107538466 (PLA2G5)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107538466 (PLA2G5)
  09154 Digestive system
   04972 Pancreatic secretion
    107538466 (PLA2G5)
   04975 Fat digestion and absorption
    107538466 (PLA2G5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107538466 (PLA2G5)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     107538466 (PLA2G5)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    107538466 (PLA2G5)
SSDB
Motif
Pfam: Phospholip_A2_1 Phospholip_A2_2
Other DBs
NCBI-GeneID: 107538466
NCBI-ProteinID: XP_016070213
LinkDB
Position
Unknown
AA seq 137 aa
MKGLLTLAWFLACVPAVPGGLLELKSMIEKVTGKSAVISYGFYGCYCGWGGRGTPKDATD
WCCQVHDHCYGLLEEKSCSIRTQSYKYRFSRGLVACELGPFCQVKLCSCDRKFVYCLKRN
LRSYNPIYQFFPNIFCT
NT seq 414 nt   +upstreamnt  +downstreamnt
atgaaggggctcctcacactggcttggttcctggcttgtgtgcctgctgtgccagggggc
ttgctggagctgaagtcaatgattgagaaggtgacgggaaagagcgccgtgatcagctac
ggcttctacggctgttactgtggctggggcggtcgagggactcccaaggatgctaccgat
tggtgttgtcaggtgcatgaccactgctatgggctgctggaggagaaaagctgcagcatc
cggacacagtcatacaaatacagattctcacggggcctggtcgcctgcgagcttgggccc
ttctgccaggtgaagctctgctcctgtgaccggaagttcgtctactgcctgaagagaaac
ctaaggagctacaaccctatttaccaattctttcccaacatcttctgcacctag

KEGG   Miniopterus natalensis: 107538467
Entry
107538467         CDS       T05883                                 

Gene name
PLA2G2D
Definition
(RefSeq) group IID secretory phospholipase A2
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
mna  Miniopterus natalensis
Pathway
mna00564  Glycerophospholipid metabolism
mna00565  Ether lipid metabolism
mna00590  Arachidonic acid metabolism
mna00591  Linoleic acid metabolism
mna00592  alpha-Linolenic acid metabolism
mna01100  Metabolic pathways
mna04014  Ras signaling pathway
mna04270  Vascular smooth muscle contraction
mna04972  Pancreatic secretion
mna04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107538467 (PLA2G2D)
   00565 Ether lipid metabolism
    107538467 (PLA2G2D)
   00590 Arachidonic acid metabolism
    107538467 (PLA2G2D)
   00591 Linoleic acid metabolism
    107538467 (PLA2G2D)
   00592 alpha-Linolenic acid metabolism
    107538467 (PLA2G2D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107538467 (PLA2G2D)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107538467 (PLA2G2D)
  09154 Digestive system
   04972 Pancreatic secretion
    107538467 (PLA2G2D)
   04975 Fat digestion and absorption
    107538467 (PLA2G2D)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107538467 (PLA2G2D)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     107538467 (PLA2G2D)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    107538467 (PLA2G2D)
SSDB
Motif
Pfam: Phospholip_A2_1
Other DBs
NCBI-GeneID: 107538467
NCBI-ProteinID: XP_016070214
LinkDB
Position
Unknown
AA seq 147 aa
MELPLLCALVVFAGVTPTQGGILNLNKMVSQVTRKTSITTYWPYGCHCGLGGKGIPLDDS
DWCCHAHDCCYAHLKFHRCRYHTDNYKYSFSEGDIQCSDKGSWCEQQLCACDKEVAFCLK
RNMGTYKKKLRFARFSRSRCRGQTPMC
NT seq 444 nt   +upstreamnt  +downstreamnt
atggaacttcccctgctgtgtgcactggtggtgtttgctggtgtgactccaacccagggc
gggattctgaacctgaacaagatggtcagccaagtgaccaggaagacatccatcaccacc
tattggccctacggctgtcactgtggacttggtggcaaaggcatacccttagatgactca
gactggtgctgccacgctcatgactgctgctacgcccacctgaagtttcaccgttgtcgt
taccacacggacaattacaagtacagcttttccgagggggacatccagtgctctgacaaa
gggagctggtgtgagcagcagctgtgtgcctgtgacaaggaggtggccttctgtctgaag
cgtaacatgggcacctacaagaagaagctgcgtttcgcccgtttctccaggtcccgctgc
aggggccaaactcccatgtgctag

KEGG   Miniopterus natalensis: 107544563
Entry
107544563         CDS       T05883                                 

Gene name
PLA2G6
Definition
(RefSeq) 85/88 kDa calcium-independent phospholipase A2
  KO
K16343  calcium-independent phospholipase A2 [EC:3.1.1.4]
Organism
mna  Miniopterus natalensis
Pathway
mna00564  Glycerophospholipid metabolism
mna00565  Ether lipid metabolism
mna00590  Arachidonic acid metabolism
mna00591  Linoleic acid metabolism
mna00592  alpha-Linolenic acid metabolism
mna01100  Metabolic pathways
mna04014  Ras signaling pathway
mna04270  Vascular smooth muscle contraction
mna04666  Fc gamma R-mediated phagocytosis
mna04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107544563 (PLA2G6)
   00565 Ether lipid metabolism
    107544563 (PLA2G6)
   00590 Arachidonic acid metabolism
    107544563 (PLA2G6)
   00591 Linoleic acid metabolism
    107544563 (PLA2G6)
   00592 alpha-Linolenic acid metabolism
    107544563 (PLA2G6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107544563 (PLA2G6)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    107544563 (PLA2G6)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107544563 (PLA2G6)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107544563 (PLA2G6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mna03029]
    107544563 (PLA2G6)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     107544563 (PLA2G6)
Mitochondrial biogenesis [BR:mna03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Other mitophagy factors
    107544563 (PLA2G6)
SSDB
Motif
Pfam: Ank_4 Ank_2 Ank Ank_5 Ank_3 Patatin
Other DBs
NCBI-GeneID: 107544563
NCBI-ProteinID: XP_016077958
LinkDB
Position
Unknown
AA seq 806 aa
MQFFGRLVNTLSSVTSLFSNPFRVKEVSVADYTSSDRVREEGQLILSHNSSSRTWDCILV
NPRDLQNGFRLFQLETEGEALATFQQYSSLLPPFYESSARILQVEVLQQLTDLIRSHPSW
SVAHLAVELGIRECFHHSRIISCANSTESKEGCTPLHLACRKGDAEILLELVQYCQAQMD
VTDNNGETAFHYAVQGDNSQVLQLLGKNSSAGLNQVNNQGLTPLHLACQMGKQEMVHVLL
LCSARCNVMGPRGYPIHTAMKFSQKGCAEMIVGMDSSQVHSKDPRYGASPLHWAKNAEMA
RMLLKRGCDVNSTSSAGNTALHVAVMRNRFDCVIVLLTYGANSSARGEHGNTPLHLAMSR
GNVEMIKALIVFGAEVDTPNDCGETPAHIASKIGKLVTRKTVLTLLRAIGADHHLPLLPE
APAEPCSPAAQHFFCPERSQPPTISLNNLELQDLVHISRARKPAFILSSLRDEKRTHDNL
LCLDGGGVKGLVIIQLLIAIEKASGVATKDLFDWVAGTSTGGILALAILHGKSMVYMRGV
YFRMKDEVFHGSRPYESGPLEEFLKREFGEHTKMTDVKKPKVMLTGTLCDRQPAELHLFR
NYEAPECVREPRFSQNMNLKPLTQPSEQLVWRAARSSGAAPTYFRPDGRFLDGGLLANNP
TLDAMTEIHEYNQDMIHKGQGSKVKKLSVVVSLGTGKSPQVPVTCVDVFRPSNPWELAKT
VFGAKELGKMVVDCCTDPDGRAVDRARAWCEMVGIQYFRLNPQLGTDIMLDEVSDTVLVN
ALWETEVYIYEHREQFQKLVQLLLSQ
NT seq 2421 nt   +upstreamnt  +downstreamnt
atgcaattctttgggcgcctggttaacaccctcagcagcgtcaccagcttgttctctaat
ccgttccgggtgaaggaggtgtctgtggctgactacacctcgagcgaccgggttcgggag
gaagggcagctgatcctgtcccataactcttccagccgcacctgggactgcatcctggtc
aaccccagggacttgcagaatggattccggctcttccagctggagacggagggggaagcc
ctagccaccttccagcagtattcctccctgctgccgcccttctacgagagctccgcccgc
atcctgcaggtcgaggtcctgcagcagctcaccgacctcatccgcagccaccccagctgg
tcggtggcccacctggcggtggagctgggcatccgggagtgcttccatcacagccgcatc
atcagctgtgccaacagcacagagagtaaggagggctgcacacccctgcacctggcctgc
cgcaagggtgatgcggagatcctgctggagctggtgcagtactgccaggcccagatggac
gtcaccgacaacaacggagagactgccttccattacgctgtccagggtgacaattcccag
gtgctgcagctcctagggaagaactcgtcggccggcctgaaccaggtgaacaaccagggg
ctgaccccgctgcacctggcctgccagatggggaagcaggagatggtccacgtgctgctg
ctgtgcagtgcccgctgcaacgtgatggggccccgcggataccccatccacacggccatg
aagttctcccagaaggggtgtgccgaaatgattgttggcatggacagcagccaggtccac
agcaaagacccacgctatggagccagccccctccactgggccaagaacgcagagatggct
cgcatgctgctgaaacgaggctgcgatgtgaacagcaccagctccgcgggcaacacagct
ctgcatgtggccgtgatgcgcaaccgctttgactgcgtcatagtgttgctgacctacggg
gccaacagcagcgcccgcggcgagcacggcaacacgccgctgcacctggccatgtcgaga
ggcaacgtggagatgatcaaggccctcattgtgtttggggcagaggtggacaccccaaat
gactgtggggagactcctgctcacatagcctccaagatcggcaaacttgtcaccaggaag
acagtcttaactctgctgagagccataggggccgaccaccacctcccactcctcccagag
gccccagcggagccgtgctccccagcagcacaacatttcttctgcccggaaagatctcag
cccccaacgatcagcttaaacaacctagagctgcaggacctggttcacatctcccgggcc
cggaagccagccttcatcttgagctccctgcgggatgagaagcggacccatgacaacctg
ctctgcctggacggagggggtgtgaaaggcctggtcatcatccagctcctcatagccata
gagaaggcctcgggcgtcgccaccaaggacctctttgactgggtggctggcaccagcacg
ggaggcatcctggccctggccattctgcacggcaagtccatggtctacatgcgtggcgtg
tactttcgcatgaaggacgaagtcttccatggctcgcggccctacgagtcagggcccctg
gaggagttcctgaagcgggagtttggggagcacaccaaaatgacagacgtcaagaagccc
aaggtgatgctgacagggactctgtgtgaccggcagccggcggaactccatctcttccgg
aattacgaggccccggagtgtgtacgggagcctcgtttcagccagaatatgaacctgaag
cctctaactcaaccctcagagcagctggtgtggcgggcagcccggagcagtggggcagcc
cccacctacttccggcctgatgggcgcttcctggatggtgggctgctggccaacaacccc
acgctggacgccatgaccgagatccatgagtacaaccaggacatgatccacaagggtcag
ggcagcaaggtgaagaaactctccgtcgtcgtctctctggggacagggaagtccccacag
gtacctgtgacctgtgtggacgtcttccgccccagcaacccctgggaactggctaagact
gtttttggggccaaggagctgggcaaaatggtggtggactgttgcacggatccagatggg
cgagccgtggaccgggcccgggcctggtgtgagatggtcggcatccagtacttcagattg
aacccccagctggggacagacatcatgctggatgaagtcagcgacacagtgctggtcaac
gccctctgggagactgaggtctacatttacgagcaccgggagcagttccagaagctcgtc
cagctgctgctgtcacagtag

KEGG   Miniopterus natalensis: 107545802
Entry
107545802         CDS       T05883                                 

Gene name
PLA2G12B
Definition
(RefSeq) group XIIB secretory phospholipase A2-like protein
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
mna  Miniopterus natalensis
Pathway
mna00564  Glycerophospholipid metabolism
mna00565  Ether lipid metabolism
mna00590  Arachidonic acid metabolism
mna00591  Linoleic acid metabolism
mna00592  alpha-Linolenic acid metabolism
mna01100  Metabolic pathways
mna04014  Ras signaling pathway
mna04270  Vascular smooth muscle contraction
mna04972  Pancreatic secretion
mna04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107545802 (PLA2G12B)
   00565 Ether lipid metabolism
    107545802 (PLA2G12B)
   00590 Arachidonic acid metabolism
    107545802 (PLA2G12B)
   00591 Linoleic acid metabolism
    107545802 (PLA2G12B)
   00592 alpha-Linolenic acid metabolism
    107545802 (PLA2G12B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107545802 (PLA2G12B)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107545802 (PLA2G12B)
  09154 Digestive system
   04972 Pancreatic secretion
    107545802 (PLA2G12B)
   04975 Fat digestion and absorption
    107545802 (PLA2G12B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107545802 (PLA2G12B)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     107545802 (PLA2G12B)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    107545802 (PLA2G12B)
SSDB
Motif
Pfam: PLA2G12
Other DBs
NCBI-GeneID: 107545802
NCBI-ProteinID: XP_016079501
LinkDB
Position
Unknown
AA seq 194 aa
MRLATGSLILWLSLGGGLAQDDSSPDADESYSNWGLRHLRGSFESVNSYFDSFLELLGGK
NGVCQYRCRYGKAPMPRPDYKPQGPNGCNSYFLGLKIPESMSLGIPAMTKCCNQLDVCYD
TCGANKYRCDAKFRWCLHSICSDLKRSLGFVSNVATCDSLADTVFNTVWTLGCRPFMNSQ
RAACVCAGEEKEEL
NT seq 585 nt   +upstreamnt  +downstreamnt
atgaggctggccaccggctccctgattctgtggctcagcctggggggtggcctggcacag
gacgacagcagccctgacgcagacgagtcctattcaaactggggcctgcggcacctccgg
ggcagcttcgagtcggtcaacagctacttcgattccttcctggagctgctgggagggaag
aacggagtctgtcagtacaggtgccgatacggaaaggcaccaatgcccagacctgactac
aagcctcaggggcccaacggctgcaactcctacttcctgggtctcaagataccagaaagt
atgagcttgggcattccagcaatgaccaagtgctgcaaccagctggatgtctgctatgac
acttgcggtgccaacaagtatcgctgtgatgcaaaattccgatggtgcctccactctatc
tgctctgaccttaagcgaagtctgggctttgtctccaacgtggcaacatgcgactcgctg
gccgataccgtgttcaacactgtctggaccttgggctgccggcccttcatgaacagccag
cgcgcagcctgcgtgtgcgccggggaggagaaggaagagctgtga

KEGG   Miniopterus natalensis: 107546298
Entry
107546298         CDS       T05883                                 

Gene name
PLA2G4A
Definition
(RefSeq) cytosolic phospholipase A2 isoform X1
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
mna  Miniopterus natalensis
Pathway
mna00564  Glycerophospholipid metabolism
mna00565  Ether lipid metabolism
mna00590  Arachidonic acid metabolism
mna00591  Linoleic acid metabolism
mna00592  alpha-Linolenic acid metabolism
mna01100  Metabolic pathways
mna04010  MAPK signaling pathway
mna04014  Ras signaling pathway
mna04072  Phospholipase D signaling pathway
mna04217  Necroptosis
mna04270  Vascular smooth muscle contraction
mna04370  VEGF signaling pathway
mna04611  Platelet activation
mna04664  Fc epsilon RI signaling pathway
mna04666  Fc gamma R-mediated phagocytosis
mna04724  Glutamatergic synapse
mna04726  Serotonergic synapse
mna04730  Long-term depression
mna04750  Inflammatory mediator regulation of TRP channels
mna04912  GnRH signaling pathway
mna04913  Ovarian steroidogenesis
mna04921  Oxytocin signaling pathway
mna05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107546298 (PLA2G4A)
   00565 Ether lipid metabolism
    107546298 (PLA2G4A)
   00590 Arachidonic acid metabolism
    107546298 (PLA2G4A)
   00591 Linoleic acid metabolism
    107546298 (PLA2G4A)
   00592 alpha-Linolenic acid metabolism
    107546298 (PLA2G4A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107546298 (PLA2G4A)
   04014 Ras signaling pathway
    107546298 (PLA2G4A)
   04370 VEGF signaling pathway
    107546298 (PLA2G4A)
   04072 Phospholipase D signaling pathway
    107546298 (PLA2G4A)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107546298 (PLA2G4A)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107546298 (PLA2G4A)
   04664 Fc epsilon RI signaling pathway
    107546298 (PLA2G4A)
   04666 Fc gamma R-mediated phagocytosis
    107546298 (PLA2G4A)
  09152 Endocrine system
   04912 GnRH signaling pathway
    107546298 (PLA2G4A)
   04913 Ovarian steroidogenesis
    107546298 (PLA2G4A)
   04921 Oxytocin signaling pathway
    107546298 (PLA2G4A)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107546298 (PLA2G4A)
  09156 Nervous system
   04724 Glutamatergic synapse
    107546298 (PLA2G4A)
   04726 Serotonergic synapse
    107546298 (PLA2G4A)
   04730 Long-term depression
    107546298 (PLA2G4A)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107546298 (PLA2G4A)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    107546298 (PLA2G4A)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     107546298 (PLA2G4A)
SSDB
Motif
Pfam: PLA2_B C2
Other DBs
NCBI-GeneID: 107546298
NCBI-ProteinID: XP_016080156
LinkDB
Position
Unknown
AA seq 749 aa
MSFIDPYQHIIVEHQYSHKFTVVVLRATKVTKGAFGDLLDTPDPYVELFISSTPDSRKRT
RHFNNDINPVWNETFEFILDPNQENVLEITLMDANYVMDETLGTATFPISSMKVGEKKEV
PFIFNQVTEMILEMSLEVCSSPDLRFSMALCDQEKAFRCQRKENIKENMKKLLGPENSEG
LCSTRDVPVVAILGSGGGFRAMVGFSGVMKALYESGVLDCATYIAGLSGSTWYMSTLYSH
PDFPEKGPEEINEELMKNVSHNPLLLLTPQKVKRYVESLWKKKRSGQPVTFADIFGMLIG
ETLIHNRMNMTLSSLKEKVNTAQCPLPLFTCLHVKPDVSELMFADWVEFTPYEIGMAKYG
TFMTPDLFGSKFFMGKVVKKYEENPLHFLMGVWGSAFSILFNRVLGVSSSQNKGSTMEEE
LENITAKHIVSNDSSDSDDESQEPKGTENEDAAEEYQNDNQASWVHRMIMALMSDSTLFN
TREGRAGKVHNFMLGLNLNTSYPLSPFRDFNTQESLDEDELDTAVTDPDEFERIYEPLDV
KSKKIHVVDSGLTFNLPYPLILRPQRGVDLIIAFDFSARPSDSSPPFKELLLAEKWAKMN
KLPFPKIDPNVFDREGLKECYVFKPKNSDMEKDCPTVIHFVLANINFRKYKAPGVPRETK
EEKEIADFDIFDDPESPFSTFNFQYPNQAFKRLHDLMYFNTLNNIDVIKNAIFESIEYRR
QNPSRCSVSLSNVEARRFFNKEFLSKPPA
NT seq 2250 nt   +upstreamnt  +downstreamnt
atgtcattcatagatccttatcagcacattatagtggagcaccagtattctcacaagttc
acggtagtggtgttacgtgccaccaaagtgacaaagggggccttcggtgacctgcttgac
accccagatccctatgtggaactgttcatctcctcaacccctgacagcaggaagagaaca
agacacttcaataatgacatcaacccagtgtggaatgagacctttgaattcattttggat
cctaatcaggaaaacgttttggagatcacgttaatggatgctaattatgtcatggatgaa
actctggggacagcaacatttcccatatcttctatgaaagtaggagagaagaaagaggtt
ccttttattttcaaccaagtcactgaaatgattctggaaatgtcccttgaagtttgttcg
tccccagacctccgatttagtatggctctgtgtgatcaggagaaagctttcagatgccag
agaaaagaaaacataaaggaaaacatgaagaagctcctgggcccagagaatagcgaaggc
ttgtgttccacacgtgatgtgcctgtggtggccatactgggctcaggtgggggtttccga
gccatggtggggttctccggtgtgatgaaggcactgtatgaatcaggagttttagactgt
gctacctacattgctggtctttctggctccacatggtatatgtcaaccttatattctcac
ccagatttcccagagaaagggccagaagagattaatgaagagctaatgaaaaatgttagc
cacaacccccttttacttctcacgccacagaaagttaagagatatgtcgagtctttatgg
aagaagaaaagatctggacaacccgtcacctttgctgatatctttgggatgttaatagga
gagacactaattcacaataggatgaacatgaccttgagtagtttgaaggaaaaagtcaat
acagcccaatgccctttacctcttttcacgtgtctacatgtcaagcccgatgtttcagag
ctgatgtttgcagattgggtcgaatttactccctatgagatcggcatggctaaatatggt
actttcatgactcctgacttatttggaagcaaattttttatgggaaaagttgtaaagaaa
tatgaagaaaaccccttgcatttcttaatgggtgtctggggcagtgccttttctatattg
ttcaacagagtcttgggagtttccagctcacaaaataaaggctccacaatggaggaagaa
ttagaaaatattacagcaaagcatattgtgagtaatgatagctccgacagcgatgatgaa
tcacaagaacccaaaggcactgaaaatgaagatgctgcagaggagtatcagaatgataac
caggcaagttgggtccatcgtatgataatggccttgatgagcgactcaactttattcaac
accagagaaggacgtgctgggaaggtgcacaacttcatgttgggcctgaacctcaatacc
tcctacccgctgtctcctttcagagactttaacacacaggagtccttggatgaagatgaa
ctggacacagctgtaaccgatcctgatgaattcgagcgaatatatgagccactggatgtc
aaaagtaagaagattcacgtcgtggacagtggcctcacctttaacctgccttaccccttg
atcctgaggcctcagaggggagtcgatctcatcatcgcctttgacttttctgcaaggccg
agtgactctagccctccattcaaggaacttctccttgcggaaaagtgggcgaaaatgaac
aagctcccctttcccaagattgaccctaacgtgtttgatcgagaaggactgaaggagtgc
tacgtctttaaacccaagaactcagacatggagaaggattgccccactgtcatccacttt
gttctggccaacatcaacttcagaaagtacaaggccccgggtgtcccaagagaaactaag
gaagagaaagaaatagctgactttgatatttttgatgaccctgaatcaccattttcaacc
ttcaactttcaatatccaaatcaagcattcaagaggctgcatgatctgatgtacttcaat
accctgaacaacatcgatgtgataaagaacgccatctttgaaagcatcgaatatagaaga
cagaatccatctcgttgctctgtttccctcagtaacgttgaggcaagaagattcttcaac
aaggagtttctaagcaaacccccagcatag

DBGET integrated database retrieval system