KEGG   Miniopterus natalensis: 107524995
Entry
107524995         CDS       T05883                                 

Gene name
GRIA3
Definition
(RefSeq) glutamate receptor 3
  KO
K05199  glutamate receptor 3
Organism
mna  Miniopterus natalensis
Pathway
mna04024  cAMP signaling pathway
mna04080  Neuroactive ligand-receptor interaction
mna04713  Circadian entrainment
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna04728  Dopaminergic synapse
mna04730  Long-term depression
mna05016  Huntington disease
mna05017  Spinocerebellar ataxia
mna05022  Pathways of neurodegeneration - multiple diseases
mna05031  Amphetamine addiction
mna05033  Nicotine addiction
mna05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107524995 (GRIA3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107524995 (GRIA3)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    107524995 (GRIA3)
   04728 Dopaminergic synapse
    107524995 (GRIA3)
   04730 Long-term depression
    107524995 (GRIA3)
   04723 Retrograde endocannabinoid signaling
    107524995 (GRIA3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107524995 (GRIA3)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    107524995 (GRIA3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    107524995 (GRIA3)
   05017 Spinocerebellar ataxia
    107524995 (GRIA3)
   05022 Pathways of neurodegeneration - multiple diseases
    107524995 (GRIA3)
  09165 Substance dependence
   05031 Amphetamine addiction
    107524995 (GRIA3)
   05033 Nicotine addiction
    107524995 (GRIA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107524995 (GRIA3)
Ion channels [BR:mna04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   107524995 (GRIA3)
SSDB
Motif
Pfam: Lig_chan Lig_chan-Glu_bd SBP_bac_3 ANF_receptor DUF2061
Other DBs
NCBI-GeneID: 107524995
NCBI-ProteinID: XP_016052556
LinkDB
Position
Unknown
AA seq 644 aa
GFTDILLERVMHGGANITGFQIVNNENPMVQQFIQRWVRLDEREFPEAKNAPLKYTSALT
HDAILVIAEAFRYLRRQRVDVSRRGSAGDCLANPAVPWSQGIDIERALKMVQVQGMTGNI
QFDTYGRRTNYTIDVYEMKVTGSRKAGYWNEYERFVPFSDHQISNDSASSENRTIVVTTI
LESPYVMYKKNHEQLEGNERYEGYCVDLAYEIAKHVRIKYKLSIVADGKYGARDPETKIW
NGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDP
LAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHLEDNNEEPRDPQSPPDPPNEFGIFNSLW
FSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAED
LAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPSVFTKTTADGVARVRKSKG
KFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSALRNAVNLAVLKLNEQGL
LDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILVGGLGLAMMVALIEFCYKS
RAESKRMKLTKNTQNFKPAPASNTQNYATYREGYNVYGTESVKI
NT seq 1935 nt   +upstreamnt  +downstreamnt
ggttttaccgatattttgctagaaagagtcatgcatgggggagcaaacattacaggattc
cagatcgtcaacaatgaaaatcctatggttcagcagttcatacagcgctgggtgaggctg
gatgaaagggaattccctgaagccaagaatgcaccactaaagtatacatctgcactgaca
cacgatgcaatattggtcatagcagaagctttccgctatctaaggaggcagcgagtggat
gtgtcccggagaggcagtgctggagactgcttagcaaatcctgctgtgccctggagtcaa
ggaattgatatcgagagagctctgaaaatggtgcaagtacaaggaatgactggaaacatc
caatttgacacttatggacgtaggacaaattatactatcgatgtgtatgaaatgaaagtg
actggctccagaaaagctggctattggaatgagtatgaaaggtttgtgcctttctcagat
caccaaatcagcaatgacagtgcatcctcagagaaccggaccatagtggtgactaccatt
ctggaatcaccatatgtaatgtataagaagaaccatgagcaactggaaggaaatgagcga
tatgaaggctattgtgtagacttagcctatgaaatagccaaacatgtaaggatcaaatac
aaattatccattgtggctgatgggaaatatggtgcaagggatccagagactaaaatatgg
aatggcatggttggggaacttgtctatgggagggctgatatagctgttgctccactcact
ataacgctggtccgtgaagaagttatagatttctcaaagccatttatgagcttgggcatc
tccatcatgataaagaagcctcagaaatcaaaaccaggagtattctcatttctggatccc
ttggcttatgaaatctggatgtgcatcgtcttcgcttacattggagtcagtgtagttctt
ttcctagtcagcagattcagcccttatgaatggcacttggaagacaacaatgaagaacct
cgtgacccgcaaagccctcctgatcctccaaatgaatttggaatattcaacagtctttgg
ttttccttgggtgcctttatgcagcaaggatgtgatatttctccaaggtcactctcaggg
cgcattgttggaggggtttggtggttcttcaccctgatcataatttcttcctatactgcc
aatctcgctgctttcctgactgtggagaggatggtttctcccatagagagtgctgaagat
ttagctaagcagactgaaattgcatatgggaccctcgactctggatcaacaaaagaattt
ttcagaaggtccaaaattgctgtctatgagaaaatgtggtcttatatgaaatcagcagag
ccatctgtgtttaccaaaacaacagcagacggcgtggcccgagtgcggaagtccaaggga
aagttcgccttcctgctggagtcaaccatgaatgagtacattgagcagagaaaaccatgt
gatacgatgaaagttggtggaaatctggattccaaaggctatggtgtggcaacccctaaa
ggctcagcattaagaaatgctgttaacctggcagtattaaaactgaatgagcaaggcctc
ttggacaaattgaaaaacaaatggtggtacgacaaaggagagtgcggcagcgggggcggt
gactccaaggacaagaccagcgctctgagcctgagcaatgtggcaggcgttttctatata
cttgttggaggtctggggctggccatgatggtggctttgatagaattctgttacaaatca
cgggcagagtccaaacgcatgaaacttacaaagaacacccaaaactttaagcctgctcct
gccagcaacactcaaaattacgctacatacagagaaggctacaacgtgtatggaactgag
agtgttaaaatctag

KEGG   Miniopterus natalensis: 107527540
Entry
107527540         CDS       T05883                                 

Gene name
GRIA2
Definition
(RefSeq) glutamate receptor 2 isoform X1
  KO
K05198  glutamate receptor 2
Organism
mna  Miniopterus natalensis
Pathway
mna04024  cAMP signaling pathway
mna04080  Neuroactive ligand-receptor interaction
mna04713  Circadian entrainment
mna04720  Long-term potentiation
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna04728  Dopaminergic synapse
mna04730  Long-term depression
mna05014  Amyotrophic lateral sclerosis
mna05016  Huntington disease
mna05017  Spinocerebellar ataxia
mna05022  Pathways of neurodegeneration - multiple diseases
mna05030  Cocaine addiction
mna05031  Amphetamine addiction
mna05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107527540 (GRIA2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107527540 (GRIA2)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    107527540 (GRIA2)
   04728 Dopaminergic synapse
    107527540 (GRIA2)
   04720 Long-term potentiation
    107527540 (GRIA2)
   04730 Long-term depression
    107527540 (GRIA2)
   04723 Retrograde endocannabinoid signaling
    107527540 (GRIA2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107527540 (GRIA2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    107527540 (GRIA2)
   05016 Huntington disease
    107527540 (GRIA2)
   05017 Spinocerebellar ataxia
    107527540 (GRIA2)
   05022 Pathways of neurodegeneration - multiple diseases
    107527540 (GRIA2)
  09165 Substance dependence
   05030 Cocaine addiction
    107527540 (GRIA2)
   05031 Amphetamine addiction
    107527540 (GRIA2)
   05033 Nicotine addiction
    107527540 (GRIA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107527540 (GRIA2)
Ion channels [BR:mna04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   107527540 (GRIA2)
SSDB
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 Peripla_BP_6 DUF2061
Other DBs
NCBI-GeneID: 107527540
NCBI-ProteinID: XP_016055806
LinkDB
Position
Unknown
AA seq 897 aa
MQKIMHISALLSPVLWGLIFGVSSNSIQIGGLFPRGADQEYSAFRVGMVQFSTSEFRLTP
HIDNLEVANSFAVTNAFCSQFSRGVYAIFGFYDKKSVNTITSFCGTLHVSFITPSFPTDG
THPFVIQMRPDLKGALLSLIEYYQWDKFAYLYDSDRGLSTLQAVLDSAAEKKWQVTAINV
GNINNDKKDETYRSLFQDLELKKERRVILDCERDKVNDIVDQVITIGKHVKGYHYIIANL
GFTDGDLLKIQFGGANVSGFQIVDYDDSLVSKFIERWSTLEEKEYPGAHTTTIKYTSALT
YDAVQVMTEAFRNLRKQRIEISRRGNAGDCLANPAVPWGQGVEIERALKQVQVEGLSGNI
KFDQNGKRINYTINIMELKTNGPRKIGYWSEVDKMVVTLTELPSGNDTSGLENKTVVVTT
ILESPYVMMKKNHEMLDGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKI
WNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLD
PLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEFEDGRETQSSESTNEFGIFNSLWF
SLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDL
SKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGK
YAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLRTPVNLAVLKLSEQGVL
DKLKNKWWYDKGECGAKDSGSKEKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSR
AEAKRMKMILSDALRNKARLPTTGSPGGHGPVMTPEFPKAVHAVPYVSPGMGMNVRV
NT seq 2694 nt   +upstreamnt  +downstreamnt
atgcaaaagattatgcatatatctgccctcctttctcctgttttatggggactaattttt
ggtgtctcttctaacagcatacagataggggggctatttcccaggggcgccgatcaagaa
tacagtgcatttcgggtagggatggttcagttttccacttcggagttcagactaacaccg
cacatcgacaatctggaggtagcaaacagcttcgcagtcaccaatgctttctgctcccag
ttttcaagaggagtctatgctatttttggattttatgacaagaagtctgtaaataccatc
acatcgttttgtggaacgctccatgtctccttcatcactcccagcttcccgactgatggc
acacacccatttgtcattcagatgagacctgacctcaaaggagcccttcttagcttgatc
gaatactatcagtgggacaagtttgcatacctctatgacagcgacagaggcttatcaaca
ctgcaagctgtgctggattccgctgctgaaaagaaatggcaagtgactgctatcaatgtg
ggaaacattaacaacgacaagaaagatgagacctaccgatcactttttcaagatctggag
ttaaaaaaggaacggcgtgtcatcctggactgtgaacgggataaagtaaacgacattgta
gaccaggttattaccattggaaaacatgttaaagggtaccattacatcattgcaaatctg
ggatttactgatggagatctattaaaaattcagtttggaggcgcaaatgtctctggattt
cagatagtggactacgatgattctctagtatctaagtttatagaaaggtggtcaacactg
gaagaaaaagaatatcctggagcgcacacaactacaattaagtatacttctgctctgact
tatgacgctgttcaagtgatgaccgaagctttccgaaacctacggaagcagagaattgaa
atctccagaagggggaacgcaggagactgtctggcaaacccagcagtcccctggggacaa
ggtgtagaaatagaaagggccctcaaacaggttcaggttgaaggcctctcaggaaatata
aagtttgaccagaatggaaaaagaataaactatacgattaacatcatggagctcaaaacg
aatgggccccggaagattggatactggagtgaagtagacaaaatggttgttacccttact
gagctgccttctggaaacgatacctctgggcttgagaataagactgtcgttgtcactaca
attttggaatctccatatgttatgatgaagaaaaatcatgagatgcttgacggcaatgag
cgctatgagggctactgtgttgacttggctgcagaaatcgccaaacattgtgggttcaag
tacaagctgacaattgttggggatggcaagtatggggccagggatgcagacacgaaaatt
tggaatgggatggttggagaacttgtctatgggaaagctgatattgcaattgctccacta
actattacccttgtgagagaagaagtgatcgacttctcaaagccctttatgagcctcggg
atctctatcatgatcaagaagcctcagaagtccaaaccaggagtgttttcatttcttgat
cctttagcctatgagatctggatgtgcattgtttttgcctacattggggtcagtgtagtt
ttattcctggtcagcagatttagcccctacgagtggcacactgaggagtttgaagatgga
agagaaacacaaagtagtgaatcaactaatgaatttgggatttttaatagtctctggttt
tccttgggtgcctttatgcagcaaggatgcgatatttcgccaagatccctctctgggcgc
attgttggaggtgtgtggtggttctttaccctgatcataatctcctcctacacggctaac
ttagctgccttcctgactgtagagaggatggtgtctcccatcgaaagtgctgaggatctt
tctaagcaaacagaaattgcttatggaacattagactctggctccactaaagagtttttc
aggagatctaagattgcagtgtttgataaaatgtggacgtacatgagaagtgcagagccc
tctgtgtttgtgaggactacagccgagggggtggcgagagtgcggaagtccaaagggaaa
tacgcctacttgctggagtccacgatgaatgagtacatcgagcaaaggaagccttgcgac
accatgaaagttggtggaaacctggattccaaaggctatggcatcgcaacacctaaagga
tcctcattaagaaccccagtaaatcttgcagtattgaaactcagtgagcaaggcgtctta
gacaagctgaaaaacaaatggtggtacgataaaggtgaatgtggagccaaggactctgga
agtaaggaaaagaccagtgccctcagtctgagcaacgtggccggagtattctacatcctg
gtcgggggccttggcctggccatgctggtggctttgattgagttctgttacaagtcaagg
gccgaggcgaaacgaatgaagatgatcttgagcgatgccctgaggaacaaggcaaggctg
cccacgacaggcagccctggaggacatggacctgttatgactccagagtttccaaaagca
gtgcatgctgtcccttacgtgagtcctggcatgggaatgaatgtccgtgtgtga

KEGG   Miniopterus natalensis: 107532917
Entry
107532917         CDS       T05883                                 

Gene name
GRIA4
Definition
(RefSeq) glutamate receptor 4 isoform X1
  KO
K05200  glutamate receptor 4
Organism
mna  Miniopterus natalensis
Pathway
mna04024  cAMP signaling pathway
mna04080  Neuroactive ligand-receptor interaction
mna04713  Circadian entrainment
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna04728  Dopaminergic synapse
mna05016  Huntington disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05031  Amphetamine addiction
mna05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107532917 (GRIA4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107532917 (GRIA4)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    107532917 (GRIA4)
   04728 Dopaminergic synapse
    107532917 (GRIA4)
   04723 Retrograde endocannabinoid signaling
    107532917 (GRIA4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107532917 (GRIA4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    107532917 (GRIA4)
   05022 Pathways of neurodegeneration - multiple diseases
    107532917 (GRIA4)
  09165 Substance dependence
   05031 Amphetamine addiction
    107532917 (GRIA4)
   05033 Nicotine addiction
    107532917 (GRIA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107532917 (GRIA4)
Ion channels [BR:mna04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   107532917 (GRIA4)
SSDB
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 Peripla_BP_6 DUF2061
Other DBs
NCBI-GeneID: 107532917
NCBI-ProteinID: XP_016062928
LinkDB
Position
Unknown
AA seq 902 aa
MRIICRQIVLLFSGFWGLAMGAFPSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNASEA
PFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITP
SFPTEGESQFVLQLRPSLRGALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWH
VSAICVENFNDVSYRQLLEELDRRQEKKFVIDCEIERLQNILEQIVSVGKHVKGYHYIIA
NLGFKDISLERFIHGGANVTGFQLVDFNTPIVTKLMDRWKKLDQREYPGSETPPKYTSAL
TYDGVLVMAETFRSLRRQKIDISRRGNAGDCLANPAAPWGQGIDMERTLKQVRIQGLTGN
VQFDHYGRRVNYTMDVFELKSTGPRKVGYWNDMDKLVLIQDVPTLGNDTAAIENRTVVVT
TIMESPYVMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTK
IWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFL
DPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLW
FSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAED
LAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKG
KFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSSLRTPVNLAVLKLSEAGV
LDKLKNKWWYDKGECGPKDSGSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKS
RAEAKRMKLTFSEAIRNKARLSITGSVGENGRVLTPDCPKAVHAGTAIRQSSGLAVIASD
LP
NT seq 2709 nt   +upstreamnt  +downstreamnt
atgaggattatttgcagacagattgtcttgttgttttctggattttggggactcgccatg
ggagcctttccgagcagcgtgcagataggtggcctcttcatccgaaacacagatcaggaa
tacactgcttttcggttagcgatttttcttcataacaccagccccaatgcgtcggaagcg
cctttcaatttggtacctcatgtggacaacattgagacggccaacagttttgctgtaaca
aatgctttctgttcccagtattctagaggagtctttgccatttttggactctatgataag
aggtcggtgcataccttgacctccttctgcagcgccttacacatctccctgatcaccccg
agcttccctacggagggggagagccagtttgtgctgcagctgaggccttccttgcgaggc
gcactcttgagcctgctggatcactatgaatggaactgttttgtcttcctgtacgacaca
gacaggggatattcaatacttcaagctattatggaaaaggcaggacaaaatggttggcat
gtcagcgctatatgtgtggaaaattttaatgatgtcagctatagacaacttctagaagaa
cttgatagaagacaagagaagaaatttgtaatagactgtgagatagagaggcttcaaaac
atattagaacagattgtgagtgttggaaagcatgttaaaggctaccattatatcatcgca
aacttgggattcaaggatatttctcttgagaggtttatacacggtggagccaatgttaca
ggattccagttggtagattttaatacacctattgtaaccaagctaatggaccgctggaag
aaactcgatcagagagagtatccaggatctgagactcctccaaagtacacatccgctctg
acttatgatggcgtcctggtgatggccgaaacttttcgaagtcttagaaggcagaaaatt
gatatttcaaggagaggcaatgctggggattgtctagcaaatcctgctgctccatggggc
cagggaattgacatggaaaggacactcaaacaggttcgaattcaaggactgacagggaac
gttcagtttgaccactatggacgtagggtcaattacacaatggatgtgtttgagttaaag
agcacagggccgagaaaggttggttactggaacgatatggataaattagtcttgattcaa
gatgtacccactcttggcaatgacacagcagctattgagaacaggacagtggttgtaacc
actattatggaatccccatatgttatgtacaagaaaaatcacgaaatgtttgaaggaaat
gacaagtatgaaggctactgtgtagatttggcatctgaaattgcaaaacatattggtatc
aagtataaaattgccattgtccctgatggaaagtatggagcaagggatgcagacacaaaa
atctggaatgggatggtaggagaacttgtttatgggaaagcagagattgctattgcccct
ctgacaatcactttggtccgagaggaggtcattgacttctctaagcccttcatgagtttg
ggcatatctatcatgatcaaaaagcctcagaaatctaaaccaggagtgttttccttcttg
gatcctctggcctatgagatctggatgtgcatagtctttgcctacattggtgtcagcgtg
gtcttgttcctagttagtaggtttagtccatatgagtggcacacagaagagccagaggat
ggaaaggaaggacccagcgaccagcctcccaatgagtttggcatctttaacagcctctgg
ttttccctgggtgcttttatgcagcaaggatgtgacatttcacccaggtccctgtcgggt
cggatcgtgggcggagtgtggtggttcttcacgctcatcatcatctcctcctacaccgcc
aacctcgccgctttcctcaccgtggagcggatggtctcgcccatcgagagcgcggaagac
ctggccaaacaaacagagatcgcctacgggacgctggactcggggtccacgaaggaattc
ttcagaagatcaaaaatagcagtgtatgaaaaaatgtggacctacatgcggtcagccgag
ccgtcggtgttcacgaggaccacggccgagggcgtggcgcgggtccgcaagtccaagggc
aagttcgccttcctcctggagtccacgatgaacgagtacatcgagcagcgaaagccctgc
gacaccatgaaagtgggaggaaacctcgattccaaaggctatggagtggccacgcccaag
gggtcctcattaagaactcctgtaaaccttgccgttttgaaactcagtgaggcaggcgtc
ttagacaagctgaaaaacaaatggtggtacgataaaggtgaatgcggacccaaggactct
ggaagcaaggacaagacgagtgccttgagcctgagcaacgtagcaggcgtcttctacatt
ctggttggcggcctgggcttggcaatgctggtggctttgatagagttctgttacaagtcc
agggcagaagcgaagagaatgaagctgaccttttctgaagccataagaaacaaagccagg
ttatccatcaccgggagcgtgggtgagaacggccgcgtgctgacgcccgactgcccaaag
gctgtccacgctggaactgcaatcagacaaagttcaggattggctgtcattgcatcggac
ctaccataa

KEGG   Miniopterus natalensis: 107537716
Entry
107537716         CDS       T05883                                 

Gene name
GRIA1
Definition
(RefSeq) glutamate receptor 1 isoform X1
  KO
K05197  glutamate receptor 1
Organism
mna  Miniopterus natalensis
Pathway
mna04024  cAMP signaling pathway
mna04080  Neuroactive ligand-receptor interaction
mna04713  Circadian entrainment
mna04720  Long-term potentiation
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna04728  Dopaminergic synapse
mna04730  Long-term depression
mna05014  Amyotrophic lateral sclerosis
mna05016  Huntington disease
mna05017  Spinocerebellar ataxia
mna05022  Pathways of neurodegeneration - multiple diseases
mna05031  Amphetamine addiction
mna05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107537716 (GRIA1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107537716 (GRIA1)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    107537716 (GRIA1)
   04728 Dopaminergic synapse
    107537716 (GRIA1)
   04720 Long-term potentiation
    107537716 (GRIA1)
   04730 Long-term depression
    107537716 (GRIA1)
   04723 Retrograde endocannabinoid signaling
    107537716 (GRIA1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107537716 (GRIA1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    107537716 (GRIA1)
   05016 Huntington disease
    107537716 (GRIA1)
   05017 Spinocerebellar ataxia
    107537716 (GRIA1)
   05022 Pathways of neurodegeneration - multiple diseases
    107537716 (GRIA1)
  09165 Substance dependence
   05031 Amphetamine addiction
    107537716 (GRIA1)
   05033 Nicotine addiction
    107537716 (GRIA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107537716 (GRIA1)
Ion channels [BR:mna04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   107537716 (GRIA1)
SSDB
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 DUF659 DUF2061 Peripla_BP_6
Other DBs
NCBI-GeneID: 107537716
NCBI-ProteinID: XP_016069278
LinkDB
Position
Unknown
AA seq 906 aa
MQHIFAFFCTGFLGAAVGANFPSNIQIGGLFPNQQSQEHAAFRFALSQLTEPPKLLPQID
IVNISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVDTSNQ
FVLQLRPELQDALISIIDHYKWQKFVYIYDADRGLSVLQKVLDTAAEKNWQVTAVNILTT
TEEGYRMLFQDLEKKKERLVVVDCESERLNAILGQIIKLEKNGIGYHYILANLGFMDIDL
NKFKESGANVTGFQLVNYTDTIPAKIMQQWKNSDTRDHTRVDWKRPKYTSALTYDGVKVM
AEAFQSLRRQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKGR
RTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYV
MLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGE
LVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIW
MCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQ
QGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIA
YGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLES
TMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRGPVNLAVLKLSEQGVLDKLKSKW
WYDKGECGSKDSGSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK
GFCLIPQQSINEAIRTSTLPRNSGAGASGGSSGENGRVVSHDFPKSMQSIPCMSHSSGMP
LGATGL
NT seq 2721 nt   +upstreamnt  +downstreamnt
atgcagcacatcttcgccttcttctgcaccgggttcctaggcgcggcagtaggtgccaat
ttccccagcaacatccagatcgggggattatttccaaaccagcagtcacaggaacatgcc
gcttttagatttgctttgtcgcaactcacagagcccccgaagctcctcccccagattgat
attgtgaacatcagcgacagctttgagatgacctatagattctgttcccagttctccaaa
ggtgtctatgccatctttgggttttatgaacggaggaccgtcaacatgctgacctccttc
tgcggggccctccatgtctgcttcatcacgccgagctttcctgttgacacatccaaccag
tttgtccttcagctgcgccccgagctgcaggatgccctcatcagtattatcgaccattac
aagtggcagaaatttgtctacatttacgatgctgaccggggtttgtccgtcctgcagaaa
gtcctggacacagctgctgagaagaactggcaggtgacagcagtcaacattttgacaacc
acggaagagggataccggatgctctttcaggacctggagaagaaaaaagagcggctggtg
gtggtggactgtgaatcggaacgcctcaacgctatcttgggccagattatcaagctggag
aagaatggtattggctaccactacatccttgcaaacctgggtttcatggacatcgactta
aacaaattcaaggagagtggagcaaatgtgacaggtttccagttggtgaactacacagac
accatcccagccaagataatgcagcagtggaagaacagcgacactcgagaccacacccgg
gtggactggaagagacctaagtacacctctgcgctcacctacgatggagtgaaggtgatg
gctgaggctttccagagcctgcgaaggcagagaatcgatatatcccgccggggcaatgct
ggggactgtctggctaacccagctgtgccctggggccaggggatcgacatccagagagct
ctgcagcaggtgcggtttgagggcctgacaggaaatgtgcagtttaatgagaaagggcgc
cggaccaactacaccctccatgtgattgagatgaagcatgacggcatccgaaagattggt
tactggaatgaagatgacaagtttgtccctgcagccactgatgctcaagctgggggggat
aattcaagtgtccagaatagaacgtacatcgtcactacaatcctagaagatccttatgtg
atgctcaagaagaacgccaaccagtttgagggcaatgaccgctatgagggctactgtgtg
gagctggcggcagagattgccaagcatgtgggctactcctaccgtcttgagatagtcagc
gatggaaaatacggagcccgcgaccctgacacaaaggcttggaatggcatggtgggagag
ctggtctatggaagagcagatgtggctgtagcccctttaacaatcaccttggtccgggag
gaggtgatagacttctccaagccatttatgagtttggggatctccatcatgataaaaaag
ccgcagaagtccaagccgggggtcttctccttccttgatcctttggcctatgagatttgg
atgtgcattgtgtttgcctacatcggagtgagcgttgtccttttcctggtcagccgtttc
agcccctatgagtggcacagtgaagagtttgaggaagggcgggaccagacaaccagcgac
cagtccaatgagtttgggatattcaacagcctgtggttctccctgggagccttcatgcag
caaggatgtgacatttctcccaggtccctgtccggccgcatcgttggtggtgtctggtgg
ttcttcactttgatcatcatctcctcatacacagccaacctggccgccttcttgaccgtg
gagaggatggtgtcgcccatcgagagtgctgaggacctagcgaagcagacggaaattgca
tacgggacattggaagcaggatccactaaggagttcttcaggaggtctaaaattgccgtg
tttgagaagatgtggacatacatgaagtcagcagaaccatcagtgtttgtacggaccacg
gaggaggggatgatccgagtgaggaaatccaaaggcaaatatgcctaccttctggagtcc
actatgaatgagtacattgagcagcggaagccctgtgacaccatgaaggtgggaggtaac
ttggattccaaaggctatggcattgcgacacccaaggggtccgccctgagaggtcccgta
aacctagcggttttgaaactcagtgagcaaggcgtcttagacaagctgaaaagcaaatgg
tggtacgataaaggggaatgtggaagcaaggactccggaagtaaggacaagacaagcgct
ctgagcctcagcaatgtggcgggcgtgttctacatcctgatcggaggacttggactagcc
atgctggttgccttaatcgagttctgctacaaatcccgtagcgagtccaagcggatgaag
ggtttctgtttgatcccacagcaatccatcaatgaagccatacggacatcgacactcccc
cgaaacagcggggcaggagccagtggtggcagcagtggagagaatggccgagtggtcagc
cacgacttcccgaagtccatgcaatcaattccctgcatgagccacagttcagggatgccc
ttgggagccacaggattataa

DBGET integrated database retrieval system