KEGG   Miniopterus natalensis: 107528307
Entry
107528307         CDS       T05883                                 

Gene name
SP1
Definition
(RefSeq) transcription factor Sp1
  KO
K04684  transcription factor Sp1
Organism
mna  Miniopterus natalensis
Pathway
mna01522  Endocrine resistance
mna04137  Mitophagy - animal
mna04350  TGF-beta signaling pathway
mna04915  Estrogen signaling pathway
mna04927  Cortisol synthesis and secretion
mna04928  Parathyroid hormone synthesis, secretion and action
mna04934  Cushing syndrome
mna05016  Huntington disease
mna05017  Spinocerebellar ataxia
mna05163  Human cytomegalovirus infection
mna05200  Pathways in cancer
mna05202  Transcriptional misregulation in cancer
mna05224  Breast cancer
mna05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    107528307 (SP1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    107528307 (SP1)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107528307 (SP1)
   04928 Parathyroid hormone synthesis, secretion and action
    107528307 (SP1)
   04927 Cortisol synthesis and secretion
    107528307 (SP1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107528307 (SP1)
   05202 Transcriptional misregulation in cancer
    107528307 (SP1)
   05231 Choline metabolism in cancer
    107528307 (SP1)
  09162 Cancer: specific types
   05224 Breast cancer
    107528307 (SP1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    107528307 (SP1)
   05017 Spinocerebellar ataxia
    107528307 (SP1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107528307 (SP1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    107528307 (SP1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107528307 (SP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mna03000]
    107528307 (SP1)
   03029 Mitochondrial biogenesis [BR:mna03029]
    107528307 (SP1)
Transcription factors [BR:mna03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    107528307 (SP1)
Mitochondrial biogenesis [BR:mna03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    107528307 (SP1)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_8 zf-C2H2_6
Other DBs
NCBI-GeneID: 107528307
NCBI-ProteinID: XP_016056839
LinkDB
Position
Unknown
AA seq 878 aa
MPTAFHISCTKTCFLSLSLCRELRPSFGITEPVHVLYVLQLSLLSHPFPLPPSTGTFHLP
VSHVCFLITFSTLPHLTLFLPSNFKLFIFSFFLDQDHSMDEMTAVVKIEKGVGGNNGGNG
NGGGAFSQARSSSTGSSSSSGGGGGQESQPSPLALLAATCSRIESPNENSNNSQGPSQSG
GTGELDLTATQLSQGANGWQIISSSSGATPTSKEQSGSSTNGSNGSESSKNRTVSGGQYV
VAATSNLQNQQVLTGLPGVMPNIQYQVIPQFQTVDGQQLQFAATGAQVQQDGSGQIQIIP
GANQQIITNRGSGGNIIAAMPNLLQQAVPLQGLANNVLSGQTQYVTNVPVALNGNITLLP
VNSVSAATLTPSSQAVTISSSGSQESGSQPVTSGTAISSASLVSSQASSSSFFTNANSYS
TTTTTSNMGIMNFTTSGSAGTNSQGQTPQRVSGLQGSDALNIQQNQTSGSSLQASQQKEG
EQNQQSQQQQQILIQPQLVQGGQTLQALQAAPLSGQTFTTQAISQETLQNLQLQAVPNSG
PIIIRTPTVGPNGQVSWQTLQLQNLQVQNPQAQTITLAPMQGVSLGQTSSSNTTLTPIAS
AASIPTGTVTVNAAQLSSMPGLQTINLSALGASGIQVHQLPSLPLTIANAPGDHGAQLGL
HGAGGDGIHDDTAGGEEGENSPDPQPQAGRRTRREACTCPYCKDSEGRGSGDPGKKKQHI
CHIQGCGKVYGKTSHLRAHLRWHTGERPFMCTWSYCGKRFTRSDELQRHKRTHTGEKKFA
CPECPKRFMRSDHLSKHIKTHQNKKGGTGVALSVGTLPLDSGAGSEGSGAATSSALITTN
MVAMEAICPEGIARLANSGINVMQVADLQSINISGNGF
NT seq 2637 nt   +upstreamnt  +downstreamnt
atgcccactgcctttcacatttcctgtaccaaaacatgttttctgagtttaagtttgtgc
agagagttgaggcccagttttggcatcactgagccagttcatgtcctatacgtcctacaa
ctgtcccttctctcccatccatttcccctccccccctccactggcacctttcaccttcct
gttagtcatgtctgtttcctcataaccttctctacccttcctcaccttacccttttcctt
ccctccaactttaaattgtttatcttttcattctttttagaccaagatcactccatggat
gaaatgacagccgtggtgaagattgagaaaggagttggtggcaataatgggggcaatggt
aatggtggtggtgccttttctcaggctcgaagcagcagcacaggcagtagcagcagcagt
ggaggaggtggaggacaggaatcacagccatctcctttagctctgttggcagcaacttgc
agcagaattgaatctcccaatgaaaacagcaacaactcccagggcccaagccagtcaggg
ggcacaggtgagcttgacctcacagctacacaactctcacagggtgccaatggctggcag
atcatctcttcctcctctggggctactcctacctcaaaggaacagagtggcagtagtacc
aatggcagcaatggcagtgagtcttccaagaatcgtacagtctctggtgggcagtatgtt
gtggctgccacctccaatttacagaaccagcaagtcctgacaggactacctggtgtgatg
cctaatattcagtatcaagtaatcccacagttccagaccgttgatgggcaacagctgcag
ttcgctgccactggcgcccaagtgcagcaggatggttctggtcaaatacagattatacca
ggtgcaaaccagcagatcatcacaaatcgaggaagtggaggcaacatcattgctgctatg
ccaaatctactccagcaggctgtccccctccaaggtctggctaataatgtcctctcagga
cagactcagtatgtgaccaatgtgccggtggccctgaatgggaatatcaccttgctacct
gttaacagtgtttctgcagctaccttgactcctagctctcaggcagtcacgatcagcagc
tctgggtcccaggagagtggctcacaacccgtcacctcagggactgccattagttctgcc
agtttggtatcgtcacaagccagttccagttcctttttcaccaatgccaatagctattca
acaactactaccaccagcaacatgggaattatgaactttaccaccagcggatcagcaggg
accaactctcaaggccagacaccccagagggttagtgggctacagggatctgatgctctg
aacatccagcagaaccagacatctggaagttcactgcaagcaagtcagcaaaaagaggga
gagcaaaaccagcagtcacagcagcaacaacaaattcttatccagcctcagctagttcaa
gggggacagaccctccaggctcttcaagcagcaccattgtcagggcagacctttacaact
caagctatctcccaggaaaccctccagaacctccagcttcaggctgttccaaactctggc
cccatcatcatccggacaccaacagtggggcccaatggacaggtcagttggcagactctt
cagctgcagaacctccaagttcaaaaccctcaggctcagacaatcaccttggctccaatg
cagggtgtttccctggggcagaccagcagcagcaataccacacttacacccatagcctca
gctgcctctatccccacgggcacagtcactgtgaatgctgctcaactgtcctccatgcct
ggccttcagactattaacctcagtgctttgggtgcttcaggaatccaggtgcaccagctt
ccaagcctgccattgactatagcaaatgccccaggtgatcatggagctcagcttggcctc
catggggctggtggtgatggaatacatgatgacacagcaggaggagaggaaggagagaac
agcccagatccccaacctcaagctggtcggaggacccggcgggaagcgtgcacctgcccc
tactgtaaagacagtgaaggaaggggctctggagatcctggcaaaaagaaacagcacatt
tgccacattcaaggctgtggcaaagtatatggcaagacctcacacctacgggcacatttg
cgctggcacacaggcgagaggccattcatgtgtacctggtcatactgtgggaaacgcttc
acacgttcggatgagctgcagaggcacaaacgcacacacacaggtgagaagaaatttgcc
tgccctgagtgtcccaagcgcttcatgaggagtgaccacctgtcaaagcatatcaagacc
caccagaataagaagggaggcacaggcgtagccctgagtgtgggcactttgcccctggac
agtggggcaggttcagaaggcagtggtgctgccacttcttcagcccttattaccaccaat
atggtagccatggaggccatctgtccagagggtattgcccgtcttgctaacagtggcatc
aacgtcatgcaggtggcggatctgcagtccattaatatcagtggcaatggcttctga

DBGET integrated database retrieval system