Miniopterus natalensis (Natal long-fingered bat): 107533389 Help Entry 107533389         CDS       T05883                                  Name (RefSeq) myosin light polypeptide 6-like   KO K12751   myosin light chain 6 Organism mna  Miniopterus natalensis (Natal long-fingered bat) Pathway mna04270   Vascular smooth muscle contraction mna04530   Tight junction mna04814   Motor proteins mna04921   Oxytocin signaling pathway Brite KEGG Orthology (KO) [BR:mna00001]  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     107533389   09142 Cell motility    04814 Motor proteins     107533389  09150 Organismal Systems   09152 Endocrine system    04921 Oxytocin signaling pathway     107533389   09153 Circulatory system    04270 Vascular smooth muscle contraction     107533389  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mna04812]     107533389    04147 Exosome [BR:mna04147]     107533389 Cytoskeleton proteins [BR:mna04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      107533389 Exosome [BR:mna04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    107533389   Exosomal proteins of bladder cancer cells    107533389 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_5 Motif Other DBs NCBI-GeneID:  107533389 NCBI-ProteinID:  XP_016063555 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MCDFTKNETAEFKEAFQLFDRTEDGKIAYSQYMMRSPGQNPTHAEVPKVLGNPKSDEMNV KLLDFEHFLPVLQTVAKSKDQGTNEDCVEGLRVFGREGNGTVLGAEIIHVLATLSEKVTE EDVGILVAGHEDSNGCINYEELICLGLSG NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atgtgtgacttcaccaagaacgagaccgcagaattcaaggaggccttccagctgtttgac agaacagaggatggcaagattgcatacagccagtacatgatgaggtccccgggccagaac cccacccacgccgaggtgcccaaagtcctggggaaccccaagagtgatgagatgaatgtg aagctgttggactttgagcacttcctgcccgtgctgcagactgtggccaagagcaaggac cagggcaccaatgaggactgtgtcgaaggccttagggtgtttggcagggaggggaatggc actgtcttgggtgctgagatcatacatgttctagccacactgagtgagaaggtgacagag gaagatgtagggatcctagtggcagggcacgaggacagcaatggttgtatcaactatgaa gagctcatttgtttggggctgagtggctga

Miniopterus natalensis (Natal long-fingered bat): 107542167 Help Entry 107542167         CDS       T05883                                  Symbol MYL9 Name (RefSeq) myosin regulatory light polypeptide 9   KO K12755   myosin regulatory light chain 9 Organism mna  Miniopterus natalensis (Natal long-fingered bat) Pathway mna04022   cGMP-PKG signaling pathway mna04024   cAMP signaling pathway mna04270   Vascular smooth muscle contraction mna04360   Axon guidance mna04510   Focal adhesion mna04520   Adherens junction mna04530   Tight junction mna04670   Leukocyte transendothelial migration mna04810   Regulation of actin cytoskeleton mna04814   Motor proteins mna04820   Cytoskeleton in muscle cells mna04921   Oxytocin signaling pathway mna05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mna00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     107542167 (MYL9)    04022 cGMP-PKG signaling pathway     107542167 (MYL9)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     107542167 (MYL9)    04520 Adherens junction     107542167 (MYL9)    04530 Tight junction     107542167 (MYL9)   09142 Cell motility    04814 Motor proteins     107542167 (MYL9)    04820 Cytoskeleton in muscle cells     107542167 (MYL9)    04810 Regulation of actin cytoskeleton     107542167 (MYL9)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     107542167 (MYL9)   09152 Endocrine system    04921 Oxytocin signaling pathway     107542167 (MYL9)   09153 Circulatory system    04270 Vascular smooth muscle contraction     107542167 (MYL9)   09158 Development and regeneration    04360 Axon guidance     107542167 (MYL9)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     107542167 (MYL9)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mna04812]     107542167 (MYL9)    04147 Exosome [BR:mna04147]     107542167 (MYL9) Cytoskeleton proteins [BR:mna04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      107542167 (MYL9) Exosome [BR:mna04147]  Exosomal proteins   Exosomal proteins of hepatic cells    107542167 (MYL9) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 AIF-1 EF-hand_5 EF-hand_11 EF-hand_9 EF_EFCAB10_C GPHH SPARC_Ca_bdg Motif Other DBs NCBI-GeneID:  107542167 NCBI-ProteinID:  XP_016074888 LinkDB All DBs Position Unknown AA seq 172 aa AA seqDB search MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLAS LGKNPTDEYLEGMMSEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHE DHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD NT seq 519 nt NT seq  +upstreamnt  +downstreamnt atgtccagcaagagggccaaggccaagaccaccaagaagcgcccacagcgggccacatcc aatgtctttgcgatgtttgaccagtcccagatccaggagtttaaagaggccttcaacatg atcgaccagaaccgagatggcttcattgacaaggaggacttgcatgacatgctggcatca ctggggaagaaccccacggacgagtacctggagggcatgatgagcgaggcccctgggccc atcaacttcaccatgttcctgaccatgtttggggagaagctgaatggcacggaccctgag gacgtgatccgcaacgccttcgcctgcttcgatgaggaggcctcaggttttatccacgag gatcaccttcgggagctgctcaccaccatgggcgaccgcttcacagatgaggaggtggac gagatgtaccgcgaggcacccattgacaagaaaggcaacttcaactatgtggagttcacc cgcattctcaaacatggtgccaaggacaaagatgactag

Miniopterus natalensis (Natal long-fingered bat): 107544330 Help Entry 107544330         CDS       T05883                                  Name (RefSeq) myosin regulatory light polypeptide 9   KO K12755   myosin regulatory light chain 9 Organism mna  Miniopterus natalensis (Natal long-fingered bat) Pathway mna04022   cGMP-PKG signaling pathway mna04024   cAMP signaling pathway mna04270   Vascular smooth muscle contraction mna04360   Axon guidance mna04510   Focal adhesion mna04520   Adherens junction mna04530   Tight junction mna04670   Leukocyte transendothelial migration mna04810   Regulation of actin cytoskeleton mna04814   Motor proteins mna04820   Cytoskeleton in muscle cells mna04921   Oxytocin signaling pathway mna05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mna00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     107544330    04022 cGMP-PKG signaling pathway     107544330  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     107544330    04520 Adherens junction     107544330    04530 Tight junction     107544330   09142 Cell motility    04814 Motor proteins     107544330    04820 Cytoskeleton in muscle cells     107544330    04810 Regulation of actin cytoskeleton     107544330  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     107544330   09152 Endocrine system    04921 Oxytocin signaling pathway     107544330   09153 Circulatory system    04270 Vascular smooth muscle contraction     107544330   09158 Development and regeneration    04360 Axon guidance     107544330  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     107544330  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mna04812]     107544330    04147 Exosome [BR:mna04147]     107544330 Cytoskeleton proteins [BR:mna04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      107544330 Exosome [BR:mna04147]  Exosomal proteins   Exosomal proteins of hepatic cells    107544330 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 AIF-1 EF-hand_5 EF-hand_11 EF-hand_9 EF_EFCAB10_C GPHH SPARC_Ca_bdg Motif Other DBs NCBI-GeneID:  107544330 NCBI-ProteinID:  XP_016077675 LinkDB All DBs Position Unknown AA seq 172 aa AA seqDB search MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLAS LGKNPTDEYLEGMMSEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHE DHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD NT seq 519 nt NT seq  +upstreamnt  +downstreamnt atgtccagcaagagggccaaggccaagaccaccaagaagcgcccacagcgggccacatcc aatgtctttgcgatgtttgaccagtcccagatccaggagtttaaagaggccttcaacatg atcgaccagaaccgagatggcttcattgacaaggaggacttgcatgacatgctggcatca ctggggaagaaccccacggacgagtacctggagggcatgatgagcgaggcccctgggccc atcaacttcaccatgttcctgaccatgtttggggagaagctgaatggcacggaccccgag gacgtgatccgcaacgcctttgcctgcttcgatgaggaggcctcaggttttatccatgag gatcaccttcgggagctgctcaccaccatgggcgaccgcttcacagatgaggaggtggac gagatgtaccgcgaggcacccattgacaagaaaggcaacttcaactatgtggagttcacc cgcattctcaaacatggtgccaaggacaaagatgactag

Miniopterus natalensis (Natal long-fingered bat): 107546178 Help Entry 107546178         CDS       T05883                                  Symbol MYL6B Name (RefSeq) myosin light chain 6B isoform X1   KO K12751   myosin light chain 6 Organism mna  Miniopterus natalensis (Natal long-fingered bat) Pathway mna04270   Vascular smooth muscle contraction mna04530   Tight junction mna04814   Motor proteins mna04921   Oxytocin signaling pathway Brite KEGG Orthology (KO) [BR:mna00001]  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     107546178 (MYL6B)   09142 Cell motility    04814 Motor proteins     107546178 (MYL6B)  09150 Organismal Systems   09152 Endocrine system    04921 Oxytocin signaling pathway     107546178 (MYL6B)   09153 Circulatory system    04270 Vascular smooth muscle contraction     107546178 (MYL6B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mna04812]     107546178 (MYL6B)    04147 Exosome [BR:mna04147]     107546178 (MYL6B) Cytoskeleton proteins [BR:mna04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      107546178 (MYL6B) Exosome [BR:mna04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    107546178 (MYL6B)   Exosomal proteins of bladder cancer cells    107546178 (MYL6B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_8 AIF-1 EF_EFCAB10_C Motif Other DBs NCBI-GeneID:  107546178 NCBI-ProteinID:  XP_016079957 LinkDB All DBs Position Unknown AA seq 251 aa AA seqDB search MLRGAAVNPSGPTAARRPASVPYLDPAGDGCPHRHTVLWPPDIMPPKKDVPVKKPAGPSI PKPATKPAAGAPTAKTKTEPAAVPSASEKTWEPPIDLSKVVIQFNKDQLEEFKEAFELFD RVGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDELKSRRVDFETFLPMLQAVSKN RDQGTYEDYLEGLRVFDKEGNGKVMGAELRHVLTTLGEKMTEEEVETVLAGHEDSNGCIN YEAFLKHILSV NT seq 756 nt NT seq  +upstreamnt  +downstreamnt atgctccggggcgccgcggttaacccctcagggcccacggccgccaggcgccccgcctcc gtcccttacctggatcccgcaggagatgggtgcccccatcggcacactgtcctttggcca ccggacatcatgcctcccaagaaagatgttcctgtgaagaaaccagcagggccctctatc cccaagcctgctaccaagccagcagcaggggcccctacagccaagaccaagactgagcca gcagcagtcccttcagcctctgagaaaacatgggagccccccattgatctctccaaagtg gtgatccagtttaacaaggaccagctggaggagttcaaggaggcctttgagctgtttgac cgagtaggggatggcaagatcctgtacagccagtgtggggatgtgatgagggccctgggc cagaaccctaccaacgccgaggtgctcaaggttctggggaaccccaagagtgatgagcta aagtcccggcgtgtggacttcgagactttcctgcccatgctccaggccgtgtccaagaac cgagaccaaggcacatatgaggactacctggaggggcttcgggtgtttgacaaagaaggg aacggcaaagtcatgggagcagagctcagacatgtcctcaccaccctgggagagaagatg actgaagaggaagtggagactgttctggcaggacatgaagacagcaatggctgcatcaac tatgaagccttcttgaagcacatcctaagcgtttga

Miniopterus natalensis (Natal long-fingered bat): 107546180 Help Entry 107546180         CDS       T05883                                  Symbol MYL6 Name (RefSeq) myosin light polypeptide 6 isoform X1   KO K12751   myosin light chain 6 Organism mna  Miniopterus natalensis (Natal long-fingered bat) Pathway mna04270   Vascular smooth muscle contraction mna04530   Tight junction mna04814   Motor proteins mna04921   Oxytocin signaling pathway Brite KEGG Orthology (KO) [BR:mna00001]  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     107546180 (MYL6)   09142 Cell motility    04814 Motor proteins     107546180 (MYL6)  09150 Organismal Systems   09152 Endocrine system    04921 Oxytocin signaling pathway     107546180 (MYL6)   09153 Circulatory system    04270 Vascular smooth muscle contraction     107546180 (MYL6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mna04812]     107546180 (MYL6)    04147 Exosome [BR:mna04147]     107546180 (MYL6) Cytoskeleton proteins [BR:mna04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      107546180 (MYL6) Exosome [BR:mna04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    107546180 (MYL6)   Exosomal proteins of bladder cancer cells    107546180 (MYL6) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_6 EF-hand_7 AIF-1 EF_EFCAB10_C EF-hand_5 EF-hand_9 Motif Other DBs NCBI-GeneID:  107546180 NCBI-ProteinID:  XP_016079959 LinkDB All DBs Position Unknown AA seq 151 aa AA seqDB search MCDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEM NVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKM TEEEVEMLVAGHEDSNGCINYEELVRMVLNG NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atgtgtgacttcaccgaggaccagaccgcagaattcaaggaggccttccagttgtttgac cgaacaggggatggcaagatcctgtacagccagtgtggggacgtgatgagggccctgggc cagaaccccaccaacgccgaggtgctcaaagtcttgggaaaccccaagagtgatgagatg aatgtgaaggtgttggactttgagcacttcctgcccatgctgcagactgtggccaagaac aaggaccagggcacttatgaggactatgttgaaggccttagggtgtttgacaaggaaggg aacggcactgtcatgggtgctgagatccgacatgttcttgtcacactgggtgagaagatg acagaggaagaagtagagatgctggtggcagggcatgaggacagcaatggttgtatcaac tatgaagagctcgtccgcatggtgctgaatggctga

DBGET integrated database retrieval system