KEGG   Miniopterus natalensis: 107533389
Entry
107533389         CDS       T05883                                 

Definition
(RefSeq) myosin light polypeptide 6-like
  KO
K12751  myosin light chain 6
Organism
mna  Miniopterus natalensis
Pathway
mna04270  Vascular smooth muscle contraction
mna04530  Tight junction
mna04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:mna00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107533389
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107533389
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107533389
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mna04812]
    107533389
   04147 Exosome [BR:mna04147]
    107533389
Cytoskeleton proteins [BR:mna04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     107533389
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   107533389
  Exosomal proteins of bladder cancer cells
   107533389
SSDB
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_5
Other DBs
NCBI-GeneID: 107533389
NCBI-ProteinID: XP_016063555
LinkDB
Position
Unknown
AA seq 149 aa
MCDFTKNETAEFKEAFQLFDRTEDGKIAYSQYMMRSPGQNPTHAEVPKVLGNPKSDEMNV
KLLDFEHFLPVLQTVAKSKDQGTNEDCVEGLRVFGREGNGTVLGAEIIHVLATLSEKVTE
EDVGILVAGHEDSNGCINYEELICLGLSG
NT seq 450 nt   +upstreamnt  +downstreamnt
atgtgtgacttcaccaagaacgagaccgcagaattcaaggaggccttccagctgtttgac
agaacagaggatggcaagattgcatacagccagtacatgatgaggtccccgggccagaac
cccacccacgccgaggtgcccaaagtcctggggaaccccaagagtgatgagatgaatgtg
aagctgttggactttgagcacttcctgcccgtgctgcagactgtggccaagagcaaggac
cagggcaccaatgaggactgtgtcgaaggccttagggtgtttggcagggaggggaatggc
actgtcttgggtgctgagatcatacatgttctagccacactgagtgagaaggtgacagag
gaagatgtagggatcctagtggcagggcacgaggacagcaatggttgtatcaactatgaa
gagctcatttgtttggggctgagtggctga

KEGG   Miniopterus natalensis: 107542167
Entry
107542167         CDS       T05883                                 

Gene name
MYL9
Definition
(RefSeq) myosin regulatory light polypeptide 9
  KO
K12755  myosin regulatory light chain 9
Organism
mna  Miniopterus natalensis
Pathway
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04270  Vascular smooth muscle contraction
mna04360  Axon guidance
mna04510  Focal adhesion
mna04530  Tight junction
mna04670  Leukocyte transendothelial migration
mna04810  Regulation of actin cytoskeleton
mna04921  Oxytocin signaling pathway
mna05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107542167 (MYL9)
   04022 cGMP-PKG signaling pathway
    107542167 (MYL9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107542167 (MYL9)
   04530 Tight junction
    107542167 (MYL9)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107542167 (MYL9)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    107542167 (MYL9)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107542167 (MYL9)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107542167 (MYL9)
  09158 Development and regeneration
   04360 Axon guidance
    107542167 (MYL9)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107542167 (MYL9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mna04812]
    107542167 (MYL9)
   04147 Exosome [BR:mna04147]
    107542167 (MYL9)
Cytoskeleton proteins [BR:mna04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     107542167 (MYL9)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   107542167 (MYL9)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_11 GPHH SPARC_Ca_bdg DUF3741
Other DBs
NCBI-GeneID: 107542167
NCBI-ProteinID: XP_016074888
LinkDB
Position
Unknown
AA seq 172 aa
MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLAS
LGKNPTDEYLEGMMSEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHE
DHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD
NT seq 519 nt   +upstreamnt  +downstreamnt
atgtccagcaagagggccaaggccaagaccaccaagaagcgcccacagcgggccacatcc
aatgtctttgcgatgtttgaccagtcccagatccaggagtttaaagaggccttcaacatg
atcgaccagaaccgagatggcttcattgacaaggaggacttgcatgacatgctggcatca
ctggggaagaaccccacggacgagtacctggagggcatgatgagcgaggcccctgggccc
atcaacttcaccatgttcctgaccatgtttggggagaagctgaatggcacggaccctgag
gacgtgatccgcaacgccttcgcctgcttcgatgaggaggcctcaggttttatccacgag
gatcaccttcgggagctgctcaccaccatgggcgaccgcttcacagatgaggaggtggac
gagatgtaccgcgaggcacccattgacaagaaaggcaacttcaactatgtggagttcacc
cgcattctcaaacatggtgccaaggacaaagatgactag

KEGG   Miniopterus natalensis: 107544330
Entry
107544330         CDS       T05883                                 

Definition
(RefSeq) myosin regulatory light polypeptide 9
  KO
K12755  myosin regulatory light chain 9
Organism
mna  Miniopterus natalensis
Pathway
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04270  Vascular smooth muscle contraction
mna04360  Axon guidance
mna04510  Focal adhesion
mna04530  Tight junction
mna04670  Leukocyte transendothelial migration
mna04810  Regulation of actin cytoskeleton
mna04921  Oxytocin signaling pathway
mna05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107544330
   04022 cGMP-PKG signaling pathway
    107544330
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107544330
   04530 Tight junction
    107544330
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107544330
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    107544330
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107544330
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107544330
  09158 Development and regeneration
   04360 Axon guidance
    107544330
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107544330
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mna04812]
    107544330
   04147 Exosome [BR:mna04147]
    107544330
Cytoskeleton proteins [BR:mna04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     107544330
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   107544330
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_11 GPHH SPARC_Ca_bdg DUF3741
Other DBs
NCBI-GeneID: 107544330
NCBI-ProteinID: XP_016077675
LinkDB
Position
Unknown
AA seq 172 aa
MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLAS
LGKNPTDEYLEGMMSEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHE
DHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD
NT seq 519 nt   +upstreamnt  +downstreamnt
atgtccagcaagagggccaaggccaagaccaccaagaagcgcccacagcgggccacatcc
aatgtctttgcgatgtttgaccagtcccagatccaggagtttaaagaggccttcaacatg
atcgaccagaaccgagatggcttcattgacaaggaggacttgcatgacatgctggcatca
ctggggaagaaccccacggacgagtacctggagggcatgatgagcgaggcccctgggccc
atcaacttcaccatgttcctgaccatgtttggggagaagctgaatggcacggaccccgag
gacgtgatccgcaacgcctttgcctgcttcgatgaggaggcctcaggttttatccatgag
gatcaccttcgggagctgctcaccaccatgggcgaccgcttcacagatgaggaggtggac
gagatgtaccgcgaggcacccattgacaagaaaggcaacttcaactatgtggagttcacc
cgcattctcaaacatggtgccaaggacaaagatgactag

KEGG   Miniopterus natalensis: 107546178
Entry
107546178         CDS       T05883                                 

Gene name
MYL6B
Definition
(RefSeq) myosin light chain 6B isoform X1
  KO
K12751  myosin light chain 6
Organism
mna  Miniopterus natalensis
Pathway
mna04270  Vascular smooth muscle contraction
mna04530  Tight junction
mna04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:mna00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107546178 (MYL6B)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107546178 (MYL6B)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107546178 (MYL6B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mna04812]
    107546178 (MYL6B)
   04147 Exosome [BR:mna04147]
    107546178 (MYL6B)
Cytoskeleton proteins [BR:mna04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     107546178 (MYL6B)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   107546178 (MYL6B)
  Exosomal proteins of bladder cancer cells
   107546178 (MYL6B)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_9
Other DBs
NCBI-GeneID: 107546178
NCBI-ProteinID: XP_016079957
LinkDB
Position
Unknown
AA seq 251 aa
MLRGAAVNPSGPTAARRPASVPYLDPAGDGCPHRHTVLWPPDIMPPKKDVPVKKPAGPSI
PKPATKPAAGAPTAKTKTEPAAVPSASEKTWEPPIDLSKVVIQFNKDQLEEFKEAFELFD
RVGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDELKSRRVDFETFLPMLQAVSKN
RDQGTYEDYLEGLRVFDKEGNGKVMGAELRHVLTTLGEKMTEEEVETVLAGHEDSNGCIN
YEAFLKHILSV
NT seq 756 nt   +upstreamnt  +downstreamnt
atgctccggggcgccgcggttaacccctcagggcccacggccgccaggcgccccgcctcc
gtcccttacctggatcccgcaggagatgggtgcccccatcggcacactgtcctttggcca
ccggacatcatgcctcccaagaaagatgttcctgtgaagaaaccagcagggccctctatc
cccaagcctgctaccaagccagcagcaggggcccctacagccaagaccaagactgagcca
gcagcagtcccttcagcctctgagaaaacatgggagccccccattgatctctccaaagtg
gtgatccagtttaacaaggaccagctggaggagttcaaggaggcctttgagctgtttgac
cgagtaggggatggcaagatcctgtacagccagtgtggggatgtgatgagggccctgggc
cagaaccctaccaacgccgaggtgctcaaggttctggggaaccccaagagtgatgagcta
aagtcccggcgtgtggacttcgagactttcctgcccatgctccaggccgtgtccaagaac
cgagaccaaggcacatatgaggactacctggaggggcttcgggtgtttgacaaagaaggg
aacggcaaagtcatgggagcagagctcagacatgtcctcaccaccctgggagagaagatg
actgaagaggaagtggagactgttctggcaggacatgaagacagcaatggctgcatcaac
tatgaagccttcttgaagcacatcctaagcgtttga

KEGG   Miniopterus natalensis: 107546180
Entry
107546180         CDS       T05883                                 

Gene name
MYL6
Definition
(RefSeq) myosin light polypeptide 6 isoform X1
  KO
K12751  myosin light chain 6
Organism
mna  Miniopterus natalensis
Pathway
mna04270  Vascular smooth muscle contraction
mna04530  Tight junction
mna04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:mna00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107546180 (MYL6)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107546180 (MYL6)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107546180 (MYL6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mna04812]
    107546180 (MYL6)
   04147 Exosome [BR:mna04147]
    107546180 (MYL6)
Cytoskeleton proteins [BR:mna04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     107546180 (MYL6)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   107546180 (MYL6)
  Exosomal proteins of bladder cancer cells
   107546180 (MYL6)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_8 EF-hand_5 EF-hand_9
Other DBs
NCBI-GeneID: 107546180
NCBI-ProteinID: XP_016079959
LinkDB
Position
Unknown
AA seq 151 aa
MCDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEM
NVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKM
TEEEVEMLVAGHEDSNGCINYEELVRMVLNG
NT seq 456 nt   +upstreamnt  +downstreamnt
atgtgtgacttcaccgaggaccagaccgcagaattcaaggaggccttccagttgtttgac
cgaacaggggatggcaagatcctgtacagccagtgtggggacgtgatgagggccctgggc
cagaaccccaccaacgccgaggtgctcaaagtcttgggaaaccccaagagtgatgagatg
aatgtgaaggtgttggactttgagcacttcctgcccatgctgcagactgtggccaagaac
aaggaccagggcacttatgaggactatgttgaaggccttagggtgtttgacaaggaaggg
aacggcactgtcatgggtgctgagatccgacatgttcttgtcacactgggtgagaagatg
acagaggaagaagtagagatgctggtggcagggcatgaggacagcaatggttgtatcaac
tatgaagagctcgtccgcatggtgctgaatggctga

DBGET integrated database retrieval system