KEGG   Mus pahari (shrew mouse): 110312812Help
Entry
110312812         CDS       T05929                                 

Gene name
Pten
Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah00562  Inositol phosphate metabolism
mpah01100  Metabolic pathways
mpah01521  EGFR tyrosine kinase inhibitor resistance
mpah04068  FoxO signaling pathway
mpah04070  Phosphatidylinositol signaling system
mpah04071  Sphingolipid signaling pathway
mpah04115  p53 signaling pathway
mpah04140  Autophagy - animal
mpah04150  mTOR signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04218  Cellular senescence
mpah04510  Focal adhesion
mpah04931  Insulin resistance
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05200  Pathways in cancer
mpah05206  MicroRNAs in cancer
mpah05213  Endometrial cancer
mpah05214  Glioma
mpah05215  Prostate cancer
mpah05218  Melanoma
mpah05222  Small cell lung cancer
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05230  Central carbon metabolism in cancer
mpah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    110312812 (Pten)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    110312812 (Pten)
   04070 Phosphatidylinositol signaling system
    110312812 (Pten)
   04071 Sphingolipid signaling pathway
    110312812 (Pten)
   04151 PI3K-Akt signaling pathway
    110312812 (Pten)
   04150 mTOR signaling pathway
    110312812 (Pten)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110312812 (Pten)
  09143 Cell growth and death
   04115 p53 signaling pathway
    110312812 (Pten)
   04218 Cellular senescence
    110312812 (Pten)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110312812 (Pten)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110312812 (Pten)
   05206 MicroRNAs in cancer
    110312812 (Pten)
   05230 Central carbon metabolism in cancer
    110312812 (Pten)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110312812 (Pten)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110312812 (Pten)
   05214 Glioma
    110312812 (Pten)
   05218 Melanoma
    110312812 (Pten)
   05215 Prostate cancer
    110312812 (Pten)
   05213 Endometrial cancer
    110312812 (Pten)
   05224 Breast cancer
    110312812 (Pten)
   05222 Small cell lung cancer
    110312812 (Pten)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    110312812 (Pten)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110312812 (Pten)
   05165 Human papillomavirus infection
    110312812 (Pten)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110312812 (Pten)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mpah01009]
    110312812 (Pten)
Enzymes [BR:mpah01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     110312812 (Pten)
    3.1.3.48  protein-tyrosine-phosphatase
     110312812 (Pten)
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     110312812 (Pten)
Protein phosphatases and associated proteins [BR:mpah01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    110312812 (Pten)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase Y_phosphatase3 PTPlike_phytase DUF3256
Motif
Other DBs
NCBI-GeneID: 110312812
NCBI-ProteinID: XP_021042368
Ensembl: MGP_PahariEiJ_G0014372
LinkDB All DBs
Position
1
AA seq 403 aa AA seqDB search
MTAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSK
HKNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVA
AIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSY
LLKNHLDYRPVALLFHKMMFETIPMFSGGTCNPQFVVCQLKVKIYSSNSGPTRREDKFMY
FEFPQPLPVCGDIKVEFFHKQNKMLKKDKMFHFWVNTFFIPGPEETSEKVENGSLCDQEI
DSICSIERADNDKEYLVLTLTKNDLDKANKDKANRYFSPNFKVKLYFTKTVEEPSNPEAS
SSTSVTPDVSDNEPDHYRYSDTTDSDPENEPFDEDQHSQITKV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgacagccatcatcaaagagatcgttagcagaaacaaaaggagatatcaagaggatgga
ttcgacttagacttgacctatatttatccaaatattattgctatgggatttcctgcagaa
agacttgaaggtgtatacaggaacaatattgatgatgtagtaaggtttttggattcaaag
cataaaaaccattacaagatatacaatctatgtgctgagagacattatgacaccgccaaa
tttaactgcagagttgcacagtatccttttgaagaccataacccaccacagctagagctt
atcaaacccttctgtgaagatcttgaccaatggctaagtgaagatgacaatcatgttgca
gcaattcactgtaaagctggaaagggacggactggtgtaatgatttgtgcatatttattg
catcggggcaaatttttaaaggcacaagaggccctagatttttatggggaagtaaggacc
agagacaaaaagggagtaactattcccagtcagaggcgctatgtatattattatagctac
ctgttaaagaatcacctggattacagaccagtggcattgttgtttcacaagatgatgttt
gaaactattccaatgttcagtggcggaacttgcaatcctcagtttgtggtctgccagcta
aaggtgaagatatattcctccaattcaggacccacgcggcgggaggacaagttcatgtac
tttgagttccctcagccattgcctgtgtgtggtgacatcaaagtagagttcttccacaaa
cagaacaagatgctcaaaaaggacaaaatgtttcacttttgggtaaatacgttcttcata
ccaggaccagaggaaacctcagaaaaagtggaaaatggaagtctttgtgatcaggaaatc
gatagcatttgcagtatagagcgtgcagataatgacaaggagtatcttgtactcacccta
acaaaaaacgatcttgacaaagcaaacaaagacaaagccaaccgatacttttctccaaat
tttaaggtgaaactatactttacaaaaacagtagaggagccatcaaatccagaggctagc
agttcaacttctgtgactccagatgttagtgacaatgaacctgatcattatagatattct
gacaccactgactctgacccagagaatgaaccttttgatgaagatcagcattcacaaatt
acaaaagtctga

DBGET integrated database retrieval system