KEGG   Mus pahari (shrew mouse): 110317041
Entry
110317041         CDS       T05929                                 

Gene name
Rela
Definition
(RefSeq) transcription factor p65
  KO
K04735  transcription factor p65
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01523  Antifolate resistance
mpah04010  MAPK signaling pathway
mpah04014  Ras signaling pathway
mpah04024  cAMP signaling pathway
mpah04062  Chemokine signaling pathway
mpah04064  NF-kappa B signaling pathway
mpah04066  HIF-1 signaling pathway
mpah04071  Sphingolipid signaling pathway
mpah04137  Mitophagy - animal
mpah04151  PI3K-Akt signaling pathway
mpah04210  Apoptosis
mpah04211  Longevity regulating pathway
mpah04218  Cellular senescence
mpah04380  Osteoclast differentiation
mpah04613  Neutrophil extracellular trap formation
mpah04620  Toll-like receptor signaling pathway
mpah04621  NOD-like receptor signaling pathway
mpah04622  RIG-I-like receptor signaling pathway
mpah04623  Cytosolic DNA-sensing pathway
mpah04625  C-type lectin receptor signaling pathway
mpah04657  IL-17 signaling pathway
mpah04658  Th1 and Th2 cell differentiation
mpah04659  Th17 cell differentiation
mpah04660  T cell receptor signaling pathway
mpah04662  B cell receptor signaling pathway
mpah04668  TNF signaling pathway
mpah04722  Neurotrophin signaling pathway
mpah04917  Prolactin signaling pathway
mpah04920  Adipocytokine signaling pathway
mpah04926  Relaxin signaling pathway
mpah04931  Insulin resistance
mpah04932  Non-alcoholic fatty liver disease
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah05010  Alzheimer disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05030  Cocaine addiction
mpah05132  Salmonella infection
mpah05133  Pertussis
mpah05134  Legionellosis
mpah05135  Yersinia infection
mpah05140  Leishmaniasis
mpah05142  Chagas disease
mpah05145  Toxoplasmosis
mpah05146  Amoebiasis
mpah05152  Tuberculosis
mpah05160  Hepatitis C
mpah05161  Hepatitis B
mpah05162  Measles
mpah05163  Human cytomegalovirus infection
mpah05164  Influenza A
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05171  Coronavirus disease - COVID-19
mpah05200  Pathways in cancer
mpah05202  Transcriptional misregulation in cancer
mpah05203  Viral carcinogenesis
mpah05212  Pancreatic cancer
mpah05215  Prostate cancer
mpah05220  Chronic myeloid leukemia
mpah05221  Acute myeloid leukemia
mpah05222  Small cell lung cancer
mpah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mpah05321  Inflammatory bowel disease
mpah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110317041 (Rela)
   04014 Ras signaling pathway
    110317041 (Rela)
   04064 NF-kappa B signaling pathway
    110317041 (Rela)
   04668 TNF signaling pathway
    110317041 (Rela)
   04066 HIF-1 signaling pathway
    110317041 (Rela)
   04071 Sphingolipid signaling pathway
    110317041 (Rela)
   04024 cAMP signaling pathway
    110317041 (Rela)
   04151 PI3K-Akt signaling pathway
    110317041 (Rela)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    110317041 (Rela)
  09143 Cell growth and death
   04210 Apoptosis
    110317041 (Rela)
   04218 Cellular senescence
    110317041 (Rela)
 09150 Organismal Systems
  09151 Immune system
   04613  Neutrophil extracellular trap formation
    110317041 (Rela)
   04620 Toll-like receptor signaling pathway
    110317041 (Rela)
   04621 NOD-like receptor signaling pathway
    110317041 (Rela)
   04622 RIG-I-like receptor signaling pathway
    110317041 (Rela)
   04623 Cytosolic DNA-sensing pathway
    110317041 (Rela)
   04625 C-type lectin receptor signaling pathway
    110317041 (Rela)
   04660 T cell receptor signaling pathway
    110317041 (Rela)
   04658 Th1 and Th2 cell differentiation
    110317041 (Rela)
   04659 Th17 cell differentiation
    110317041 (Rela)
   04657 IL-17 signaling pathway
    110317041 (Rela)
   04662 B cell receptor signaling pathway
    110317041 (Rela)
   04062 Chemokine signaling pathway
    110317041 (Rela)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    110317041 (Rela)
   04917 Prolactin signaling pathway
    110317041 (Rela)
   04926 Relaxin signaling pathway
    110317041 (Rela)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110317041 (Rela)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110317041 (Rela)
  09149 Aging
   04211 Longevity regulating pathway
    110317041 (Rela)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110317041 (Rela)
   05202 Transcriptional misregulation in cancer
    110317041 (Rela)
   05203 Viral carcinogenesis
    110317041 (Rela)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110317041 (Rela)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    110317041 (Rela)
   05221 Acute myeloid leukemia
    110317041 (Rela)
   05220 Chronic myeloid leukemia
    110317041 (Rela)
   05215 Prostate cancer
    110317041 (Rela)
   05222 Small cell lung cancer
    110317041 (Rela)
  09163 Immune disease
   05321 Inflammatory bowel disease
    110317041 (Rela)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110317041 (Rela)
   05022 Pathways of neurodegeneration - multiple diseases
    110317041 (Rela)
  09165 Substance dependence
   05030 Cocaine addiction
    110317041 (Rela)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110317041 (Rela)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110317041 (Rela)
   04931 Insulin resistance
    110317041 (Rela)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110317041 (Rela)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110317041 (Rela)
   05135 Yersinia infection
    110317041 (Rela)
   05133 Pertussis
    110317041 (Rela)
   05134 Legionellosis
    110317041 (Rela)
   05152 Tuberculosis
    110317041 (Rela)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110317041 (Rela)
   05170 Human immunodeficiency virus 1 infection
    110317041 (Rela)
   05161 Hepatitis B
    110317041 (Rela)
   05160 Hepatitis C
    110317041 (Rela)
   05171 Coronavirus disease - COVID-19
    110317041 (Rela)
   05164 Influenza A
    110317041 (Rela)
   05162 Measles
    110317041 (Rela)
   05168 Herpes simplex virus 1 infection
    110317041 (Rela)
   05163 Human cytomegalovirus infection
    110317041 (Rela)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110317041 (Rela)
   05169 Epstein-Barr virus infection
    110317041 (Rela)
   05165 Human papillomavirus infection
    110317041 (Rela)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110317041 (Rela)
   05145 Toxoplasmosis
    110317041 (Rela)
   05140 Leishmaniasis
    110317041 (Rela)
   05142 Chagas disease
    110317041 (Rela)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    110317041 (Rela)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mpah03000]
    110317041 (Rela)
Transcription factors [BR:mpah03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    110317041 (Rela)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 110317041
NCBI-ProteinID: XP_021047054
Ensembl: MGP_PahariEiJ_G0014059
LinkDB
Position
1
AA seq 549 aa
MDDLFPLIFPSEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGYYEADLCPDRCIHSFQNLGIQC
VKKRDLEQAISQRIQTNNNPFHVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLLLTPVLS
HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS
QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTYETFKSIMKKSPFNGPTEPRPPTRRIAVPTRNSTSVPKPAPQPYTFPASLSTINF
DEFSPMLLPSGQISSQALALAPSSAPVLAQTMVPSSAMVPLAQPPAPVPVLAPGPPQSLS
APVPKSTQAGEGALSEALLHLQFDADEDLGALLGSNTDPGVFTDLASVDNSEFQQLLNQG
VSMSHSTAEPMLMEYPEAITRLVTGSQRPPDPAPAPLGTSGLPNGLSGDEDFSSIADMDF
SALLSQISS
NT seq 1650 nt   +upstreamnt  +downstreamnt
atggacgatctgtttcccctcatctttccctcggagccagcccaggcttctgggccttat
gtggagatcatcgagcagcccaagcagcggggcatgagattccgctataagtgcgagggt
cgctcagcgggcagtattcctggcgagagaagcacagataccaccaagacacaccccacc
atcaagatcaatggctacacaggaccaggaacagttcgaatctccctggtcaccaaggat
ccacctcaccggcctcatccacatgaacttgtggggaaggactgccgggacggctactat
gaggctgacctctgcccagaccgctgtatccatagcttccagaacctggggatccagtgt
gtgaagaagcgagacctggagcaagccattagccagcgaatccagaccaacaataacccc
tttcacgttcccatagaggagcagcgcggggactatgacttgaatgcagtgcgcctctgc
ttccaggtgacagtgagggacccagcaggcaggcccctcctcctgactcctgtcctctca
catccaatttttgataaccgggcccccaacactgccgagctcaagatctgccgagtaaac
cggaactctgggagctgcctcggtggggatgagatcttcttgctgtgtgacaaggtgcag
aaagaagacattgaggtgtatttcacgggaccaggctgggaggcacgaggctccttttca
caagctgatgtgcaccggcaagtggccattgtgttccggactcctccatacgccgacccc
agcctacaggctcctgtgcgagtctccatgcagctacgacggccttctgatcgggagctc
agtgagcccatggagttccagtacttgccagacacagatgatcgccaccggattgaagag
aaacgcaaaaggacctatgagaccttcaagagcatcatgaagaagagtcctttcaatgga
ccaactgaaccccggcctccaacccggcgtattgctgtgcctacccgaaactcaacttct
gtccccaagccagccccccagccctacaccttcccagcatccctcagcaccatcaacttt
gatgagttttcccccatgctgttaccatcggggcagatctcaagccaggccctggccttg
gcaccatcctctgccccagtcctggcccagaccatggtcccctcctcagccatggtacct
ctggctcagcccccagctcctgtcccagttctagccccgggtcctccccagtccctgtct
gcacctgttccaaagagcacgcaggccggggaaggcgcgctgtcggaagccctgctgcac
ctgcagtttgacgctgatgaagacttgggggccttgcttggcagcaacacagacccagga
gtgttcacagacctggcatctgtggacaactcagagtttcagcagctcctcaaccagggt
gtgtccatgtctcactccacagctgagcccatgctgatggagtaccctgaagctataact
cgcctggtgacagggtcccagaggccccctgacccagctcctgcacccctggggacctcg
gggcttcccaatggtctctccggagatgaagacttctcctccattgcggacatggacttc
tctgctcttttgagtcagatcagctcctaa

KEGG   Mus pahari (shrew mouse): 110319789
Entry
110319789         CDS       T05929                                 

Gene name
Nfkb1
Definition
(RefSeq) nuclear factor NF-kappa-B p105 subunit isoform X1
  KO
K02580  nuclear factor NF-kappa-B p105 subunit
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01523  Antifolate resistance
mpah04010  MAPK signaling pathway
mpah04014  Ras signaling pathway
mpah04024  cAMP signaling pathway
mpah04062  Chemokine signaling pathway
mpah04064  NF-kappa B signaling pathway
mpah04066  HIF-1 signaling pathway
mpah04071  Sphingolipid signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04210  Apoptosis
mpah04211  Longevity regulating pathway
mpah04218  Cellular senescence
mpah04380  Osteoclast differentiation
mpah04613  Neutrophil extracellular trap formation
mpah04620  Toll-like receptor signaling pathway
mpah04621  NOD-like receptor signaling pathway
mpah04622  RIG-I-like receptor signaling pathway
mpah04623  Cytosolic DNA-sensing pathway
mpah04625  C-type lectin receptor signaling pathway
mpah04657  IL-17 signaling pathway
mpah04658  Th1 and Th2 cell differentiation
mpah04659  Th17 cell differentiation
mpah04660  T cell receptor signaling pathway
mpah04662  B cell receptor signaling pathway
mpah04668  TNF signaling pathway
mpah04722  Neurotrophin signaling pathway
mpah04917  Prolactin signaling pathway
mpah04920  Adipocytokine signaling pathway
mpah04926  Relaxin signaling pathway
mpah04931  Insulin resistance
mpah04932  Non-alcoholic fatty liver disease
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah05010  Alzheimer disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05030  Cocaine addiction
mpah05132  Salmonella infection
mpah05133  Pertussis
mpah05134  Legionellosis
mpah05135  Yersinia infection
mpah05140  Leishmaniasis
mpah05142  Chagas disease
mpah05145  Toxoplasmosis
mpah05146  Amoebiasis
mpah05152  Tuberculosis
mpah05160  Hepatitis C
mpah05161  Hepatitis B
mpah05162  Measles
mpah05163  Human cytomegalovirus infection
mpah05164  Influenza A
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05171  Coronavirus disease - COVID-19
mpah05200  Pathways in cancer
mpah05202  Transcriptional misregulation in cancer
mpah05203  Viral carcinogenesis
mpah05206  MicroRNAs in cancer
mpah05212  Pancreatic cancer
mpah05215  Prostate cancer
mpah05220  Chronic myeloid leukemia
mpah05221  Acute myeloid leukemia
mpah05222  Small cell lung cancer
mpah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mpah05321  Inflammatory bowel disease
mpah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110319789 (Nfkb1)
   04014 Ras signaling pathway
    110319789 (Nfkb1)
   04064 NF-kappa B signaling pathway
    110319789 (Nfkb1)
   04668 TNF signaling pathway
    110319789 (Nfkb1)
   04066 HIF-1 signaling pathway
    110319789 (Nfkb1)
   04071 Sphingolipid signaling pathway
    110319789 (Nfkb1)
   04024 cAMP signaling pathway
    110319789 (Nfkb1)
   04151 PI3K-Akt signaling pathway
    110319789 (Nfkb1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110319789 (Nfkb1)
   04218 Cellular senescence
    110319789 (Nfkb1)
 09150 Organismal Systems
  09151 Immune system
   04613  Neutrophil extracellular trap formation
    110319789 (Nfkb1)
   04620 Toll-like receptor signaling pathway
    110319789 (Nfkb1)
   04621 NOD-like receptor signaling pathway
    110319789 (Nfkb1)
   04622 RIG-I-like receptor signaling pathway
    110319789 (Nfkb1)
   04623 Cytosolic DNA-sensing pathway
    110319789 (Nfkb1)
   04625 C-type lectin receptor signaling pathway
    110319789 (Nfkb1)
   04660 T cell receptor signaling pathway
    110319789 (Nfkb1)
   04658 Th1 and Th2 cell differentiation
    110319789 (Nfkb1)
   04659 Th17 cell differentiation
    110319789 (Nfkb1)
   04657 IL-17 signaling pathway
    110319789 (Nfkb1)
   04662 B cell receptor signaling pathway
    110319789 (Nfkb1)
   04062 Chemokine signaling pathway
    110319789 (Nfkb1)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    110319789 (Nfkb1)
   04917 Prolactin signaling pathway
    110319789 (Nfkb1)
   04926 Relaxin signaling pathway
    110319789 (Nfkb1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110319789 (Nfkb1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110319789 (Nfkb1)
  09149 Aging
   04211 Longevity regulating pathway
    110319789 (Nfkb1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110319789 (Nfkb1)
   05202 Transcriptional misregulation in cancer
    110319789 (Nfkb1)
   05206 MicroRNAs in cancer
    110319789 (Nfkb1)
   05203 Viral carcinogenesis
    110319789 (Nfkb1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110319789 (Nfkb1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    110319789 (Nfkb1)
   05221 Acute myeloid leukemia
    110319789 (Nfkb1)
   05220 Chronic myeloid leukemia
    110319789 (Nfkb1)
   05215 Prostate cancer
    110319789 (Nfkb1)
   05222 Small cell lung cancer
    110319789 (Nfkb1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    110319789 (Nfkb1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110319789 (Nfkb1)
   05022 Pathways of neurodegeneration - multiple diseases
    110319789 (Nfkb1)
  09165 Substance dependence
   05030 Cocaine addiction
    110319789 (Nfkb1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110319789 (Nfkb1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110319789 (Nfkb1)
   04931 Insulin resistance
    110319789 (Nfkb1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110319789 (Nfkb1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110319789 (Nfkb1)
   05135 Yersinia infection
    110319789 (Nfkb1)
   05133 Pertussis
    110319789 (Nfkb1)
   05134 Legionellosis
    110319789 (Nfkb1)
   05152 Tuberculosis
    110319789 (Nfkb1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110319789 (Nfkb1)
   05170 Human immunodeficiency virus 1 infection
    110319789 (Nfkb1)
   05161 Hepatitis B
    110319789 (Nfkb1)
   05160 Hepatitis C
    110319789 (Nfkb1)
   05171 Coronavirus disease - COVID-19
    110319789 (Nfkb1)
   05164 Influenza A
    110319789 (Nfkb1)
   05162 Measles
    110319789 (Nfkb1)
   05168 Herpes simplex virus 1 infection
    110319789 (Nfkb1)
   05163 Human cytomegalovirus infection
    110319789 (Nfkb1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110319789 (Nfkb1)
   05169 Epstein-Barr virus infection
    110319789 (Nfkb1)
   05165 Human papillomavirus infection
    110319789 (Nfkb1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110319789 (Nfkb1)
   05145 Toxoplasmosis
    110319789 (Nfkb1)
   05140 Leishmaniasis
    110319789 (Nfkb1)
   05142 Chagas disease
    110319789 (Nfkb1)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    110319789 (Nfkb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mpah03000]
    110319789 (Nfkb1)
Transcription factors [BR:mpah03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    110319789 (Nfkb1)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer Ank_2 Ank_4 Ank Ank_5 Ank_3 Death
Other DBs
NCBI-GeneID: 110319789
NCBI-ProteinID: XP_021051019
Ensembl: MGP_PahariEiJ_G0027110
LinkDB
Position
4
AA seq 967 aa
MADDDPYGTGQMFHLNTALTHSIFNAELYPPEIPLSTDGPYLQILEQPKQRGFRFRYVCE
GPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGI
CTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHSDLAYLQAEG
GGDRQLTDREKEIIRQAAVQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDS
KAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSP
TDVHRQFAIVFKTPKYKDVNITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRK
RQKLMPNFSDSFGGGSSGAGAGGGGMFGSGGGGGSTGSPGPGYGFSHYGFPPYGGITFHP
GATKSNSGITHGTINTKFENGPKDCAKSDDRKMKETEGEGSSLPMACTKTETVALASITE
DKDQDVGFQDNLFIEKALQLARRHANALFDYAVTGDVKMLLAVQRHLTAAQDENGDSVLH
LAIIHLHAQLVRDLLEVTSGLISDDIINMRNDLYQTPLHLAVITKQEDVVEDLLRVGADL
SLLDRWGNSVLHLAAKEGHDKILSILLKNRKAALLIDHPNGEGLNAIHIAVMSNSLPCLL
LLVAAGAEVNAQEQKSGRTALHLAVEYDNISLAGCLLLEGDAHVDSTTYDGTTPLHIAAG
RGSTRLAALLKAAGADPLVENFEPLYDLDDSWEKAGEDEGVVPGTTPLDMAANWQVFDIL
NGKPYEPVFTSDDILPQGDMKQLTEDTRLQLCKLLEIPDPDKNWATLAQKLGLGILNNAF
RLSPAPSKTLMDNYEVSGGTIKELMEALQQMGYTEAIEVIQAAFRTPATTASSPVTTAQG
HCLPLSSPSARQHIDELRDCDSVCDSGVETSFRKLSFTESLTGDSPLLSLNKMPHSYGQE
GPIEGKI
NT seq 2904 nt   +upstreamnt  +downstreamnt
atggcagacgatgatccatacggaactgggcaaatgtttcatttgaacactgctttgact
cactcaatatttaatgcagaattatatccaccagaaataccactgtcaacagatggccca
taccttcaaatattagagcaaccaaaacagaggggatttcgattccgctatgtgtgtgaa
ggtccatcccatggagggcttccgggagcctctagtgagaagaacaagaaatcctaccca
caggtcaaaatttgcaactatgtggggcctgcaaaggttatcgttcagttggtcacaaat
ggaaaaaacattcacctgcacgcccacagcctggtgggtaagcactgtgaggatgggata
tgcaccgtaacagcaggacccaaggacatggtggttggctttgcaaacctgggaatactt
catgtgactaagaaaaaggtatttgaaacactggaagcacggatgacagaggcgtgtatt
aggggctataatcctggacttctggtgcattctgaccttgcctatctacaagcagaaggc
ggaggagaccggcaactcacagacagagagaaggagatcatccgccaggcggccgtgcag
cagaccaaggagatggatctgagcgtggtgcgtctcatgttcacagccttcctcccggac
agcacgggcagcttcactcggagactggagcctgtggtgtcagacgccatctatgacagc
aaagccccgaatgcatccaacttgaaaatcgtgagaatggacagaacagcaggatgtgtg
acgggaggggaagagatttatcttctctgtgacaaggttcagaaagatgacatccagatt
cggttttatgaagaggaagaaaatggcggagtttgggaaggatttggggacttctccccc
acggatgttcatagacagtttgccattgtcttcaaaacgccaaagtataaggatgtcaac
attacaaaaccagcttctgtgtttgttcagcttcggagaaaatcggatctggaaactagt
gaaccgaaaccctttctctactatcctgaaatcaaagacaaagaggaagtacagaggaag
cgtcagaaactcatgcccaacttctcggacagtttcggcggcggcagcagtggagcagga
gctggtggtggaggcatgtttggtagtggcggtggtggagggagtaccggaagtcctggc
ccagggtatggcttctcgcactacggatttcctccttacggtgggattacattccatccc
ggagccactaaatccaactcggggatcacccatggcaccataaataccaaatttgaaaat
ggccctaaagattgtgccaagagtgatgacaggaagatgaaggaaactgaaggtgagggg
tccagcctgcccatggcctgcaccaagacggaaacagttgccctggcatccatcacagaa
gacaaggatcaggatgtggggtttcaggataacctctttattgagaaggctctgcagctc
gccaggcgacacgccaacgcccttttcgactacgcggtgactggagacgtgaagatgttg
ctggccgtgcagcgccatctcaccgctgcacaggatgagaatggggacagtgtcttacac
ttagccatcatccaccttcacgctcagctcgtgagggatctgctggaagtcacatctggt
ttgatctctgatgacatcatcaacatgagaaatgacctgtatcagacgcctttgcacttg
gccgtgatcaccaagcaggaagatgtggtagaggacttgctgagggttggggctgacctg
agcctcctggaccgctggggcaactctgtcctgcacctagctgccaaagagggacacgac
aaaatcctcagcatcctactcaagaacagaaaagcagcgctccttatcgaccaccccaac
ggggaaggtctaaatgccatccacatagctgtgatgagcaacagcctgccatgtctgctg
ctgctggtggctgctggggcggaagtcaatgctcaggagcagaagtcggggcgcacagcg
ctgcacctggccgtggagtacgacaacatctcactggctggctgcctgcttctagagggt
gatgcccacgtggacagtaccacctatgatgggactacacctctgcatatagcggctgga
agagggtccaccagactggcagctcttctcaaagcggcaggagcagaccctctggtggag
aactttgagcctctctatgacctggacgactcttgggagaaggctggagaagatgaggga
gtggtgccaggtaccacacccctggacatggctgccaactggcaggtatttgacatacta
aatgggaaaccgtatgagcccgtgttcacatctgatgacatactaccacaaggggacatg
aagcagctgacagaagacacgaggctgcaactctgcaaactgctggaaattcctgatcca
gacaaaaactgggccactctggcacagaagttgggtctggggatattgaacaatgccttc
cggctgagtcctgcgccttctaaaactctcatggacaactatgaggtctctgggggtacc
atcaaagagctgatggaggccctgcaacagatgggctacacagaggccattgaagtgatc
caggcagccttccgaaccccggcaaccacagcctccagccccgtgaccactgctcagggc
cactgtctgcctctctcatctccctccgcgaggcagcacatagatgaactccgggattgt
gacagcgtctgtgacagtggtgtggagacatccttccgcaaactcagctttacagagtca
ctcactggagacagcccactgctatctctgaacaaaatgccccacagttatgggcaggaa
ggacctattgaaggcaaaatttag

DBGET integrated database retrieval system