KEGG   Microlunatus phosphovorus: MLP_27040
Entry
MLP_27040         CDS       T01535                                 

Definition
(GenBank) transaldolase
  KO
K18287  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase [EC:4.1.2.56]
Organism
mph  Microlunatus phosphovorus
Pathway
mph00997  Biosynthesis of various secondary metabolites - part 3
mph01100  Metabolic pathways
mph01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mph00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various secondary metabolites - part 3
    MLP_27040
Enzymes [BR:mph01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.56  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase
     MLP_27040
SSDB
Motif
Pfam: DeoC
Other DBs
NCBI-ProteinID: BAK35718
UniProt: F5XI49
LinkDB
Position
2912600..2913448
AA seq 282 aa
MTTRETSSLGKQIRLNRLFNASSGRSFIVPMDHSVAIGPLGPAGHTDAVVAELGGSGVNA
VVLHKGRVRTVAPRRFTELALVVHLSASTDFAPDTTAKVLVGEVAEALRIGADAVSVHIN
VGSPTEARQLADLAHVAAECDRLGMPLLAMMYARGPAFEPSGTFAGQGGSTAVLSHLAAV
ATDLGADLVKLPWAGSVAAMREVVASSPLPVYVAGGEPKGSLADVAAFTSAVLDSGVAGL
TFGRTVFAAPSPRAAARSIARLVHQPPTHLVAVESERPQWTA
NT seq 849 nt   +upstreamnt  +downstreamnt
gtgacgaccagggaaacatcgagtctgggcaagcagatccggctcaatcggctcttcaat
gccagcagcggccggtccttcatcgtgccgatggatcactcggtggcgatcggcccgctc
ggtccggccggtcacaccgacgccgtggtcgccgagctcggcggctccggagtcaacgcg
gtcgtgctgcacaaaggccgggtacgaacggtggcgccccgccgcttcaccgagctggca
ctggtcgtgcacctgtcggcgagcaccgatttcgcccctgacaccacggcgaaggtgctg
gtcggcgaggtggccgaggcgttgcggatcggagccgatgcggtcagcgtgcacatcaac
gtcggctcgccgaccgaggcccgccagctggccgatctcgcccacgtcgcggcggagtgc
gatcggttgggcatgccgctgctcgccatgatgtacgcgcgaggtcccgcgttcgagccg
tccggcaccttcgccggtcagggcggcagcaccgccgtgctcagccacctggccgcggtg
gccaccgacctcggcgccgacctcgtcaagctgccctgggccggttcggtcgccgcgatg
cgcgaggtcgtggccagcagcccgctcccggtctacgtggccggcggcgagcccaaggga
tcgctggccgatgtcgccgccttcacctcagccgtcctcgacagtggcgtcgccggactc
accttcggcaggaccgtcttcgcggccccctcgccgcgggcagcggcgcgcagcatcgcg
cgcctggtccatcagccaccgacacatcttgtcgccgtcgaaagcgagcgtccgcagtgg
acagcctga

DBGET integrated database retrieval system