KEGG   Methylocella silvestris: Msil_0405Help
Entry
Msil_0405         CDS       T00802                                 

Definition
(GenBank) Glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
msl  Methylocella silvestris
Pathway
msl00500  Starch and sucrose metabolism
msl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Msil_0405
Enzymes [BR:msl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Msil_0405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: ACK49379
UniProt: B8EQV8
LinkDB All DBs
Position
complement(442505..443938)
Genome map
AA seq 477 aa AA seqDB search
MSAPFKQQASLDVWMRRQYGLSAAKMMSAISRVDLVKERRGFGRLLRPAKGSILASPVIA
AYDPDPDYFFHWLRDSAVIIDALRLLIESEEIARPEGLAHFSDFLGFSLTLCGLDGRSFL
AGAGDYRAKVEPHFAQFLRPEADLLAISGDDILGEPRFDPDGSIDILKWSRPQHDGPALR
VLAVARFCQSVGPGPDIFKQAEELIIRDLGFTFARWRAPSFDIWEEELGRHYYTQLVQCE
ALREGGLWLESRGAIESATAYLDASQEIAAGLDDFWSAPQGFVRSRIAAAGSGPQKELDI
ATVLAVIHAGREAGAHSVCDSRLIATLGRLEALFADAYTINTTQPGADAPAMGRYDGDRY
YSGGAYFFSTLGAAEFHFKAAQAVAKGFLHDASEWARIGLDSKHDGHHLFEALLRCGDLF
MTTVAAYTSENGDLSEQFDQTTGVQTSAKNLAWSHAAFISAYASREKALRSAKGVSP
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctcccttcaaacaacaggcgtcgctcgatgtctggatgcgccgtcaatatggg
ctttccgccgcgaaaatgatgagcgccatttcacgggtcgacctcgtcaaggagcggcgc
ggttttggacggctgttgcggccggcgaaaggctcgatcctcgcttcgcccgtgatcgcc
gcctatgatccggaccccgactatttcttccactggctgcgcgattctgccgttatcatt
gacgccttgcggctgttgatcgagagcgaggaaatcgcgcggcccgagggccttgcgcat
ttttccgatttcctcggcttcagcctgacgctgtgcggtctcgacgggcgctcatttctg
gcgggagccggcgattaccgggcgaaggtcgagcctcatttcgcgcaatttctgcggccc
gaggcggatcttctcgccatctcaggcgacgatatcttgggcgaaccgagattcgatccc
gacggttcgatcgacatcctgaaatggtcgcggccgcaacatgatgggccggccctgcgc
gtgctcgcggtcgcccgattctgccagtcggtcggcccggggccggacattttcaagcag
gcggaagagctcatcatccgcgatctcggcttcaccttcgcccgctggcgcgcgccatct
ttcgatatctgggaggaagagctcgggcgccactattatacgcagctcgtccaatgcgag
gcgttgcgcgagggcggcttatggctcgagtcgcgcggcgcaatcgagagcgccaccgca
tatcttgacgcatcgcaggagatcgccgcgggcctcgacgacttctggagcgcgccgcaa
ggttttgtacgaagccgcatcgccgcggcgggctccggcccgcaaaaggagctcgacatc
gcgaccgtgctcgctgtgatccacgccgggcgcgaggctggcgcgcatagcgtgtgcgac
tcgagactgattgcgacgcttggccggctcgaagcgcttttcgccgatgcctatacaatc
aacacgacacaaccgggcgcagacgccccggcaatgggccgctatgacggcgatcgctac
tacagcggcggcgcctattttttctcgacgctcggcgcggcagaattccatttcaaagcg
gcgcaggccgtggcgaagggtttcctccacgacgcctcggaatgggcgcgcatcgggctc
gattcaaaacatgacggtcatcatctctttgaggcgctcctgcggtgcggcgatctgttc
atgacgacggtcgccgcctacacgtcggagaacggcgacctctccgaacaattcgatcaa
acgactggcgtccagacatcggctaaaaatctcgcctggagccacgccgctttcatcagc
gcctacgccagccgggagaaggcgcttcgttccgccaaaggcgtctcgccgtga

DBGET integrated database retrieval system