KEGG   Thermothelomyces thermophila: MYCTH_2295756Help
Entry
MYCTH_2295756     CDS       T02231                                 

Definition
(RefSeq) hypothetical protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
mtm  Thermothelomyces thermophila
Pathway
mtm00010  Glycolysis / Gluconeogenesis
mtm00051  Fructose and mannose metabolism
mtm00052  Galactose metabolism
mtm00500  Starch and sucrose metabolism
mtm00520  Amino sugar and nucleotide sugar metabolism
mtm01100  Metabolic pathways
mtm01110  Biosynthesis of secondary metabolites
mtm01130  Biosynthesis of antibiotics
mtm01200  Carbon metabolism
Module
mtm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mtm_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MYCTH_2295756
   00051 Fructose and mannose metabolism
    MYCTH_2295756
   00052 Galactose metabolism
    MYCTH_2295756
   00500 Starch and sucrose metabolism
    MYCTH_2295756
   00520 Amino sugar and nucleotide sugar metabolism
    MYCTH_2295756
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    MYCTH_2295756
Enzymes [BR:mtm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     MYCTH_2295756
Membrane trafficking [BR:mtm04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    MYCTH_2295756
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 FGGY_N
Motif
Other DBs
NCBI-GeneID: 11513323
NCBI-ProteinID: XP_003659114
JGI: 2295756
UniProt: G2Q699
LinkDB All DBs
Position
1:join(3259614..3259746,3259822..3259847,3259903..3260313,3260373..3260827,3260888..3261311)
Genome map
AA seq 482 aa AA seqDB search
MAVGTLADAPKDLISEIKHLEELFTVDTAKLKEITNHFVNELAKGLSVEGGSIPMNPTWV
MSQPTGYETGSYLALDMGGTNLRVCQVTLTEQKSEFDIIQSKYRMPEELKTGDAEELWEY
IADCLQQFIETHHGDVSKLEKIPLGFTFSYPATQNYIDEGILQRWTKGFDIAGVEGRNVV
PMFEAALARRGVPIKLTALINDTTGTLVASAYTDPKMKIGCIFGTGCNAAYFEDFGSIPK
LAHVDIAPDTPMAINCEWGAFDNEHVVLPRTPYDVAIDRDSPRPGQQAFEKMIAGLYLGE
IFRLVMVDLHDKKDVNIFAGQDVSKLRKPYTLDSSFLSAIEEDPFENLSETLELFQNKLN
ISPSLPELELIRRTAELIGTRAARLSACGVAAISIKKGYKTCHVGADGSVFNKYPHFKAR
GAQALREILDWPEKKDPKEEDPIEILAAEDGSGVGAALIAALTLQRVKAGIMHGILNKEN
FV
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaggcacgctcgccgatgcgcccaaggaccttatcagtgagatcaagcacctg
gaggagctctttaccgtcgacacggccaagctaaaggagatcaccaatcacttcgtcaat
gagctcgcaaaggggttgagcgtggaggggggtagtatccccatgaacccaacatgggtc
atgtcgcaacctaccggctatgagacgggcagctacctggccctggacatgggcggcacc
aacctgcgcgtctgccaagtcactctgacggagcagaagtccgagtttgatattatccag
tcgaagtaccgcatgccggaggagctgaagacgggcgacgcagaggagctctgggagtac
attgccgactgcctgcagcagttcatcgagacgcaccacggcgacgtgtccaagctggag
aagatcccccttggcttcactttctcgtacccggccacccagaactacatcgacgagggc
atcctgcagcgctggaccaagggcttcgacattgccggcgtcgagggccgtaacgtcgtg
cccatgtttgaggccgccctcgcccggaggggagtgccgatcaagctgacggctctcatc
aacgacacgactggtaccctcgttgcctcggcctacaccgaccctaagatgaagatcggc
tgcatcttcggcacgggctgcaacgctgcctacttcgaggacttcgggtccattcccaag
ctcgcgcacgtagacatcgcacccgacacgcccatggcgatcaactgcgagtggggtgcc
ttcgacaacgagcacgtggtgctgccgcggacgccctatgatgtcgccatcgacagggac
tctccgcgcccgggccagcaggcgtttgagaagatgattgcgggcctgtacctgggcgag
atcttccgcctggtcatggtcgacctgcacgacaagaaggatgtcaacatcttcgcaggg
caggacgtctccaagctccggaagccgtacaccctggactcatccttcctgtcagcgatc
gaggaggatccgtttgagaacctctccgagacgctcgagctcttccagaacaagctgaac
atcagccccagcctgcccgagctggagctcatccggcgcaccgccgagctgattggcacc
cgcgcagcccgtctctcggcgtgcggcgtcgctgccatcagcatcaagaaggggtacaag
acgtgccacgtgggcgccgacggctccgtgttcaacaaatacccgcacttcaaggcccgc
ggcgcccaggcgctccgcgagatcctcgactggcccgagaagaaggaccctaaggaggag
gatcccatcgagatcctggctgctgaggacggcagcggtgtgggtgccgccctgattgcc
gcgctgactctgcagcgtgttaaggcgggcatcatgcacggcatcctgaacaaggagaac
tttgtgtag

DBGET integrated database retrieval system