KEGG   Meriones unguiculatus (Mongolian gerbil): 110543126
Entry
110543126         CDS       T05884                                 

Gene name
Tap1
Definition
(RefSeq) antigen peptide transporter 1
  KO
K05653  ATP-binding cassette, subfamily B (MDR/TAP), member 2
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun02010  ABC transporters
mun04145  Phagosome
mun04612  Antigen processing and presentation
mun05163  Human cytomegalovirus infection
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05170  Human immunodeficiency virus 1 infection
mun05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    110543126 (Tap1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    110543126 (Tap1)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    110543126 (Tap1)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    110543126 (Tap1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110543126 (Tap1)
   05168 Herpes simplex virus 1 infection
    110543126 (Tap1)
   05163 Human cytomegalovirus infection
    110543126 (Tap1)
   05169 Epstein-Barr virus infection
    110543126 (Tap1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mun02000]
    110543126 (Tap1)
Transporters [BR:mun02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB2, 3, 8, 9, 10 subgroups
    110543126 (Tap1)
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N ABC_ATPase SbcCD_C
Other DBs
NCBI-GeneID: 110543126
NCBI-ProteinID: XP_021485232
LinkDB
Position
Unknown
AA seq 629 aa
MAALSWLAAAPLLLLDWLLLRPGLPGIFALLVPEAPLLRVWAVGLSRWAVLGIGVRGVLR
VTEGAHGWLAALQPLAAALGLAQPGLALFRELAAWAGLRGGDSAGPLHWSSRPDVFALVY
AAALPAAALWHKLEGLWAPGGHGGAGDMVCRLLGFLGSEKRRLHLVLILLVLSCLGEMAI
PFFTGRITDWILQDKAAPSFTRNIWLMSILTIASTLLEFAGDGAYSTAMGSMHSRVHGEV
FQAVLRQETGFFLQNSAGSITSRVTDDTSKVCESISEKLNLLLWYLGRGLCLLAFMCWGS
LHLTVITLVTLPLLFLLPRKLGKVYQSLAAKVQESLAESTQVAIEALSAMPTVRSFANED
GEAQKFRQKLEEMKTLNKKEALAYVAEVWTTSISGMLLKVGILYVGGQLVIRGAVSSGNL
VSFVLYQLQFTRAVEVSLPLVSPQTTALLCLLSVPLHASPQVASVAQEPLLFGRSFRENI
AYGLTWNPTTEDITAVAMESGAHDFISRLPQGYDTEVGETGNQLSGGQRQAVALARALIR
KPRLLILDDATSALDADNQLRVRRLLYESPQRASRAVLLITQQLGLAERADHILFLKEGA
VCEQGTHLQLMELGGCYRAMVEAPEAPSD
NT seq 1890 nt   +upstreamnt  +downstreamnt
atggctgcgctctcctggctggcggccgcgccgctgctgctgctggactggctgctgctg
cgccccgggctgccggggatcttcgccctgctggtcccggaggcgccgctgctccgcgtc
tgggcggtgggactgagccgctgggccgtcctggggataggggtccgtggggtcctcagg
gtcaccgagggagcgcatggctggctggcagctttgcagccgctggcggcggcgctgggt
ttggcccagcctggacttgccttgttccgagagctggccgcctgggcaggactccgcggg
ggtgacagcgccggacccctgcactggagcagccgccccgacgtcttcgctctcgtctat
gcggcggcattgcccgcagccgccctgtggcacaagctcgagggcctctgggcgcccgga
ggccacgggggcgccggagacatggtgtgtcggctgctgggcttcctgggctccgagaag
cggcggctccacctggttctgattctcttggtcctctcctgccttggggaaatggccatc
cccttcttcaccggtcgaatcactgactggattctccaggataaggcagctcccagcttc
acccgtaacatatggctcatgtccatcctcaccatagccagcacgctgctggagtttgcc
ggcgatggcgcctacagcaccgccatgggctccatgcacagccgcgtgcacggggaggtc
tttcaggccgtcctgcgccaggagacggggttcttcctgcagaactcagcagggtccatc
acgtctcgggtgacagacgacacatccaaggtgtgtgaatccatcagcgagaagctgaac
ctgctgctgtggtacctggggcgaggcctgtgtctcctggcgttcatgtgttgggggtca
ctgcacctcactgtgatcaccctggtcactctgcccctgcttttcctcctgcctaggaag
ctggggaaagtgtaccagtctctggcagcgaaggtgcaggagtctcttgcagagtccacg
caggtggccatcgaggccctgtcagcgatgcctaccgtccggagctttgccaacgaggac
ggagaggcccagaagttcaggcagaagttggaggaaatgaagacgttgaacaagaaagag
gccttggcttatgtagctgaagtctggaccacgagtatctcgggaatgctgctgaaggtg
ggaattctgtacgtcggcgggcagctggtgatcagaggggctgtgagcagcgggaacctc
gtgtcctttgttctgtaccagcttcagttcacgagggctgttgaggtgagcctccccctc
gtcagcccccagacaacagcactcctgtgtctcctgtctgtgcctctccatgcttcacct
caggtggcctcagtggcacaagagccgctgctctttggaagaagtttccgggaaaatatc
gcctatggcctgacctggaatccaaccacggaggacatcaccgctgtggccatggagtct
ggcgcccacgatttcatctctaggctccctcagggctatgacacagaggttggggagact
gggaaccagctgtcaggaggtcagcggcaggcagtggccttggcccgagccttgatccgg
aagccacgcctgctcatcttggacgacgccaccagcgccctggatgctgacaaccagctg
cgggtgcggaggctcctgtacgagagcccacagcgggcttcccgagccgtacttctcatc
acccagcagctcggcctggcagagcgggccgaccacatcctctttctcaaagaaggcgct
gtctgcgagcagggcacacatctgcagctcatggagctcggaggctgctaccgcgccatg
gtggaggctcccgaggctccttcagactga

KEGG   Meriones unguiculatus (Mongolian gerbil): 110543246
Entry
110543246         CDS       T05884                                 

Gene name
Tap2
Definition
(RefSeq) antigen peptide transporter 2
  KO
K05654  ATP-binding cassette, subfamily B (MDR/TAP), member 3
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun02010  ABC transporters
mun04145  Phagosome
mun04612  Antigen processing and presentation
mun05163  Human cytomegalovirus infection
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05170  Human immunodeficiency virus 1 infection
mun05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    110543246 (Tap2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    110543246 (Tap2)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    110543246 (Tap2)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    110543246 (Tap2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110543246 (Tap2)
   05168 Herpes simplex virus 1 infection
    110543246 (Tap2)
   05163 Human cytomegalovirus infection
    110543246 (Tap2)
   05169 Epstein-Barr virus infection
    110543246 (Tap2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mun02000]
    110543246 (Tap2)
Transporters [BR:mun02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB2, 3, 8, 9, 10 subgroups
    110543246 (Tap2)
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_22 AAA_29 AAA_15 AAA_21 AAA_30 AAA_23 AAA_16 AAA_25 Zeta_toxin RNA_helicase SRP54 AAA_18 APS_kinase AAA_5 AAA_33
Other DBs
NCBI-GeneID: 110543246
NCBI-ProteinID: XP_021485304
LinkDB
Position
Unknown
AA seq 697 aa
MALPYLRRGASLLLADLALLGLLQGPLGSLLPLGLPGVWLEGALRLGVLWGLLGRVGGFL
PLLCLAGPLFFSLRALVGGALGAPAVRAASASWGWLLAAYAAAALGHAVWAVLSPPDAQE
KPPGQENSRALMRRLLKLSSPDLPFLLVAFFFLAMAVLGETLIPHYSGRVIDILGGDFDP
DAFASAIFFMCLFSVGSSLSAGCRGGSFLFTMSRINLRIREQLFSSLLRQDLGFFQETKT
GELSSRLSSDTSLMSRWLPFNANVLLRSLVKAVGLYFFMLRVSPRLTFLSLLDLPLTIAA
EKVYNSRHQAVLREIQDEVAKAGQVVREAVGGLQTVRSFGAEEHEVSRYREALERCRQLW
WRRDLEKELYLVVQRVMGLGIQVLILNCGVQQILAGEVTRGGLLSFLLYQEEVGHYVQNL
VYMYGDMLSNVGAAEKVFCYMDRRPDLPPPGTLAPPRMEGRVDFQDVSFSYPHLPEKPVL
QGLTFTLHPGKVTALVGPNGSGKSTVAALLQNLFQPTEGRVLLDGQPLARYEHRYLHQQV
VLVGQEPVLFSGSVKDNIAYGLRDCEDAQVMAAAQAACAGDFIGEMANGIYTEIGEKGGQ
LAVGQKQRLAIARALVRNPRVLILDEATSALDAQCEQALQAWRSQGDRTVLVIAHRLHTV
QSADQVLVLRQGRLVERDQLREDQDVYTQLVQQRLEE
NT seq 2094 nt   +upstreamnt  +downstreamnt
atggcgctgccctacctgaggcgcggggcctctctgctgctggcggacctggctttactg
gggctgctgcaggggcccctggggagtctgctccccctggggctgccgggagtgtggctg
gagggcgccctgcggcttggagtgctgtgggggctgctggggcgcgtggggggctttctg
cccctgctctgcctggccggccccctgttcttctcgctgagagccctggtggggggcgcc
ctgggcgccccggccgtcagagcggcttctgcgtcctggggctggctgctggctgcctat
gcggctgccgcgctgggccacgcggtgtgggccgtgctgagcccgccggacgcccaggag
aagccaccgggccaggagaacagcagagcgctgatgaggcggctgctgaagctctccagt
cccgacctgcctttcctcttggtggccttcttcttcctcgcgatggccgtgctgggggag
acgttgatccctcactattctggccgcgtgattgacatcttgggaggcgattttgacccg
gatgcctttgcgagcgccatctttttcatgtgcctcttctctgtggggagctccctgtcc
gccggctgccgaggaggctccttcctcttcaccatgtccaggatcaacctgcggatccga
gagcagcttttctcatccttgctgcgccaggaccttggcttcttccaggagaccaagaca
ggggagctgagctccaggctgagctcggacacctccctcatgagccgctggctccccttc
aacgccaacgtcctgctgcggagcctggtgaaggcggtgggcctctatttcttcatgctc
cgagtgtcaccccgcctcaccttcctctccctgctggacctgcccctcacgatagcggcc
gagaaggtgtacaactcccgccatcaggcggtgctaagggagatccaggatgaggtggcc
aaggcgggccaggtggtgcgcgaggcggtgggagggctgcagactgtgcgcagctttggg
gcggaagagcacgaggtcagccgctaccgggaggccctggagcggtgccgacagctgtgg
tggcgccgagacctggagaaagagctgtatttagtcgttcagagggtgatgggcttgggc
attcaggtgctgattctgaactgcggcgtgcagcagatcctggccggcgaggtcaccagg
ggcggcctgctctccttcctgctgtaccaggaggaagttggccactatgtccagaacctg
gtatacatgtatggagacatgctgagcaacgtgggcgccgccgagaaggtgttttgctac
atggaccgaaggccggatctgcccccgccggggaccctggcccctcccaggatggagggc
cgcgtggacttccaagacgtctccttctcctacccccatctgcccgagaagcccgtgctc
caggggctgacgttcacgctgcatccggggaaggtgaccgccctggtgggccccaacggg
tcggggaagagcacggtggccgccctgctgcagaacctgttccagcccaccgagggccgg
gtgctgctggacggccagcccctggcccggtatgagcaccgctacctgcaccagcaggtg
gtgctggtgggccaggagcctgtgctgttctcgggttccgtcaaggacaacattgcctac
ggcctgagggactgtgaggacgctcaagtgatggcagctgcccaggcggcctgcgcgggc
gacttcatcggggaaatggctaacggaatctacacagaaataggagagaaagggggccag
ctggccgtgggacagaagcagcgcctggccattgcccgggcccttgtgcggaacccacgg
gtcctcatcctggatgaggctaccagtgccctggacgctcagtgtgagcaggctctacag
gcctggagatcgcagggcgacaggacagtgctggtgatcgctcacaggctgcacacggtt
cagagtgcggaccaggtcctggtgctcaggcaggggcggctggtggagcgtgatcagctc
agggaggaccaggatgtctacactcagctggtgcagcagcggctggaggagtga

DBGET integrated database retrieval system