Myotis davidii (David's myotis): 102753863 Help Entry 102753863         CDS       T02992                                  Symbol CXCL12 Name (RefSeq) C-X-C motif chemokine ligand 12   KO K10031   C-X-C motif chemokine 12 Organism myd  Myotis davidii (David's myotis) Pathway myd04060   Cytokine-cytokine receptor interaction myd04061   Viral protein interaction with cytokine and cytokine receptor myd04062   Chemokine signaling pathway myd04064   NF-kappa B signaling pathway myd04360   Axon guidance myd04670   Leukocyte transendothelial migration myd04672   Intestinal immune network for IgA production myd04810   Regulation of actin cytoskeleton myd05163   Human cytomegalovirus infection myd05200   Pathways in cancer myd05323   Rheumatoid arthritis Brite KEGG Orthology (KO) [BR:myd00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     102753863 (CXCL12)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102753863 (CXCL12)    04061 Viral protein interaction with cytokine and cytokine receptor     102753863 (CXCL12)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102753863 (CXCL12)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     102753863 (CXCL12)    04672 Intestinal immune network for IgA production     102753863 (CXCL12)    04062 Chemokine signaling pathway     102753863 (CXCL12)   09158 Development and regeneration    04360 Axon guidance     102753863 (CXCL12)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102753863 (CXCL12)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     102753863 (CXCL12)   09163 Immune disease    05323 Rheumatoid arthritis     102753863 (CXCL12)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:myd04052]     102753863 (CXCL12)    00536 Glycosaminoglycan binding proteins [BR:myd00536]     102753863 (CXCL12) Cytokines and neuropeptides [BR:myd04052]  Cytokines   Chemokines    102753863 (CXCL12) Glycosaminoglycan binding proteins [BR:myd00536]  Heparan sulfate / Heparin   Chemokines    102753863 (CXCL12) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  102753863 NCBI-ProteinID:  XP_006761485 LinkDB All DBs Position Un AA seq 128 aa AA seqDB search MVKAYKSHLCLLKEQGILIVGMVTMEQAAVLFLLPLIGKPVSLSYRCPCRFFESHVARAN VKHLKILNTPNCALQIVAKLKNNNRQVCIDPKLKWIQEYLEKALNKVHRTGISPHLPLLL PQRSSDTN NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atggtcaaagcgtacaagagccatctgtgtcttctaaaagagcaggggatcctaattgtg ggcatggttaccatggagcaggcagccgtcctgttcttattgcctcttatagggaagccg gtcagcctgagctacagatgcccttgccgattcttcgagagccatgttgcaagagccaac gtcaagcatctcaaaatcctcaacactccaaactgtgcccttcagattgtggccaagctg aagaacaacaacagacaagtgtgcatcgacccgaaactgaagtggattcaggaatacctg gagaaagctttaaacaaggttcaccgcactggaatcagtccacacctgcctctacttcta cctcagcgaagctcagacaccaactag

DBGET integrated database retrieval system