KEGG   Maylandia zebra (zebra mbuna): 101466273
Entry
101466273         CDS       T02814                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04012  ErbB signaling pathway
mze04068  FoxO signaling pathway
mze04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101466273
   04068 FoxO signaling pathway
    101466273
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101466273
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 101466273
NCBI-ProteinID: XP_004560867
UniProt: A0A3P9C2S0
LinkDB
Position
LG17
AA seq 178 aa
MCNKMSDVRLSNASPVERVDARQQDNVRTSVRRNLFGRPNPEEIRRDAENSAREEVQRFR
ETYDFDLVEDRPLAPRSYDWVQDDDAPEFYSRQPHSRPRGSPGDSDRLDNDGGDRPSGLQ
PGKNGSKKRSAEDADSCSTECLTKRSRSRDGGDDDDKSDGAGSQTIRAAEERPGRLEV
NT seq 537 nt   +upstreamnt  +downstreamnt
atgtgcaacaaaatgtcagatgttcgcctttctaacgcgagcccggtggagagggtggat
gctcggcagcaggacaacgtcagaacttcggttcgcagaaatcttttcggtagaccgaac
ccagaagagatccgcagggatgcggagaattcggcgcgagaggaggtgcagcgtttcagg
gagacttacgatttcgatctggtggaagacaggccgctcgctccgcgcagttacgactgg
gtgcaagacgacgacgcaccggaattttatagcaggcagcctcacagcagaccgagaggc
tctcccggagacagcgaccggctggataacgacggcggtgacaggccgtcgggtctccaa
ccaggcaaaaacggttcgaagaaaaggagtgcagaagatgcagactcttgctccaccgag
tgtttgactaaaaggtcgcgtagtagagatggtggcgacgacgatgacaagtcggacggt
gcaggaagtcagacgataagagccgcggaggagagacccggcagactcgaggtctga

DBGET integrated database retrieval system