KEGG   Naumovozyma castellii: NCAS_0E00180Help
Entry
NCAS_0E00180      CDS       T02233                                 

Gene name
NCAS0E00180
Definition
(RefSeq) hypothetical protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
ncs  Naumovozyma castellii
Pathway
ncs00010  Glycolysis / Gluconeogenesis
ncs00051  Fructose and mannose metabolism
ncs00052  Galactose metabolism
ncs00500  Starch and sucrose metabolism
ncs00520  Amino sugar and nucleotide sugar metabolism
ncs01100  Metabolic pathways
ncs01110  Biosynthesis of secondary metabolites
ncs01130  Biosynthesis of antibiotics
ncs01200  Carbon metabolism
Module
ncs_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ncs_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ncs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NCAS_0E00180 (NCAS0E00180)
   00051 Fructose and mannose metabolism
    NCAS_0E00180 (NCAS0E00180)
   00052 Galactose metabolism
    NCAS_0E00180 (NCAS0E00180)
   00500 Starch and sucrose metabolism
    NCAS_0E00180 (NCAS0E00180)
   00520 Amino sugar and nucleotide sugar metabolism
    NCAS_0E00180 (NCAS0E00180)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    NCAS_0E00180 (NCAS0E00180)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ncs04131]
    NCAS_0E00180 (NCAS0E00180)
Enzymes [BR:ncs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     NCAS_0E00180 (NCAS0E00180)
Membrane trafficking [BR:ncs04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    NCAS_0E00180 (NCAS0E00180)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 FGGY_N
Motif
Other DBs
NCBI-GeneID: 11530364
NCBI-ProteinID: XP_003676449
UniProt: G0VF23
LinkDB All DBs
Position
5:22337..23797
Genome map
AA seq 486 aa AA seqDB search
MVHLGPKKPPARKGSMADVPKEFLEKIAELEKEFSVSTEQLKAITKHFISELDKGLSKQG
GNIPMIPTWVVDYPTGKESGDYLAIDLGGTNLRVVLVKLGGDRTFDTTQSKYKLPSALRT
TKNPDELFGFIADSLKSFVDEQFPEGVSAALPLGFTFSFPASQTKINQGILQRWTKGFDI
PNVEGHDVVELLQKQLKTRNIPIEVVALVNDTTGTLVASLYTDGETKMGVIFGTGVNGAY
YEQVSDISKLEGKLADDIPSSFPMAINCEYGSFDNENAVLPRTKYDLQIDAESPRPNQQA
YEKMSSGYYLGEVIRLVLVDYHKQGLIFKDQDVTKLNTPYIMDTSFPARVEEDPFENLEN
TDELLQKELGINATVQERKLIRRLCELVGLRAARLGVCAISAICQKRGYEAGHIAADGSV
FKLYPGFQENAAEALRDIYGWTPAKKEDYPITIIAAEDGSGVGAAVIAALTQKRLAAGKS
VGVIGA
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggttcatttaggtccaaagaaaccacctgctagaaagggctccatggctgacgtccca
aaggaattccttgaaaaaatcgctgaattggaaaaggaattcagcgtctccaccgaacaa
ttgaaggctattaccaaacatttcatctctgaattggacaaaggtttatccaagcaaggt
ggtaatattccaatgattccaacttgggtcgttgactacccaactggtaaggaatctggt
gattacttggctattgacttgggtggaaccaacttgagagttgtcttagtcaaattgggt
ggtgaccgtacttttgacactactcaatccaaatataagcttccatctgctttgagaact
actaagaacccagatgaacttttcggtttcattgctgactctttgaagtccttcgttgat
gaacaatttccagaaggtgtctccgcagctttaccattaggtttcactttctctttccca
gcttctcaaactaagattaaccaaggtatcttgcaaagatggaccaagggtttcgatatt
ccaaatgtcgaaggtcatgatgttgtcgagttattgcaaaagcaattgaagactagaaac
atcccaattgaagttgtcgctttagttaacgatactactggtactttagtcgcttctttg
tacactgatggtgaaactaaaatgggtgtcatttttggtactggtgtcaatggtgcttac
tacgaacaagtctctgacatttcaaagttggaaggtaaattggctgatgatattccatca
tctttcccaatggccattaactgtgaatacggttccttcgataacgaaaacgctgtctta
ccaagaactaagtacgatcttcaaattgatgctgaatctccaagaccaaaccaacaagct
tacgaaaagatgtcttctggttactacttgggtgaagttattcgtcttgtccttgttgat
taccacaaacaaggtttgatcttcaaagaccaagatgttaccaaattgaacactccatac
attatggatacttctttcccagctagagttgaagaagatccatttgaaaacttggaaaac
accgatgaattgttacaaaaggaattgggtatcaatgccactgttcaagaacgtaaattg
attagacgtttatgtgaattggtcggtttaagagctgctagattgggtgtctgtgctatc
tctgccatctgtcaaaagagaggttatgaagctggtcacattgctgctgacggttccgtc
ttcaagctttacccaggtttccaagaaaatgctgctgaagctttgagagacatttacgga
tggactccagctaagaaggaagattacccaattactatcattgctgctgaagatggttca
ggtgtcggtgctgctgttatcgccgctttgactcaaaagagattagccgctggtaaatct
gttggtgtcattggtgcttaa

DBGET integrated database retrieval system