KEGG   Aspergillus fischeri: NFIA_093760
Entry
NFIA_093760       CDS       T01070                                 

Definition
(RefSeq) dimethylallyl tryptophan synthase, putative
  KO
K14134  12alpha,13alpha-dihydroxyfumitremorgin C prenyltransferase [EC:2.5.1.110]
Organism
nfi  Aspergillus fischeri
Pathway
nfi00404  Staurosporine biosynthesis
nfi01100  Metabolic pathways
nfi01110  Biosynthesis of secondary metabolites
Module
nfi_M00786  Fumitremorgin alkaloid biosynthesis, tryptophan + proline => fumitremorgin C/A
Brite
KEGG Orthology (KO) [BR:nfi00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00404 Staurosporine biosynthesis
    NFIA_093760
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:nfi01006]
    NFIA_093760
Enzymes [BR:nfi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.110  12alpha,13alpha-dihydroxyfumitremorgin C prenyltransferase
     NFIA_093760
Prenyltransferases [BR:nfi01006]
 Compound prenylation
  Indole prenyltransferase
   NFIA_093760
SSDB
Motif
Pfam: Trp_DMAT
Other DBs
NCBI-GeneID: 4588782
NCBI-ProteinID: XP_001261653
UniProt: A1DA66
LinkDB
AA seq 393 aa
MTIATEISCPEEEAFQLLDKYSWFPNDDQRRWWEYTGPNLLKLLRDAQYPQKDQISCLYL
LQQLLVPYLGTFPVAGQAPLPWWSNVTTYGVPFELSWNLLHNIVRIGFEPLSHLAESGVD
AFNKIAPEECLSRLACLDNTIDLARFRHFQHQLLVTPDEERRLLEEKGPLPKSGRGQQAL
AVEFQNGGISAKAYFFPGMKSLATGLSPGKLILDSIESLALPGLKEPVHHLCNSLGLQDD
GHPTDTAIAPFLLGVDLCTPERSRLKFYVTDQVVSWDRVADMWTLRGKRLEDPQCADGLT
LLRKLWDLLEIPEGYRSNIRPDFAFGTPPPEDYRPVMMANWTLSPKKKFPDPQIYLLTVG
MNDAVVMDALVAFYEVLGWTDLASTYKDKVASY
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgaccatagcaactgagatttcgtgccctgaagaagaggcattccagctcctcgacaag
tactcgtggtttcccaacgacgaccagcgacgttggtgggaatatactgggcccaatttg
ctcaagcttctgcgtgatgctcagtatccgcagaaggaccagatttcctgcctctatctc
ctgcagcaacttctggttccatacctcggcaccttcccagtcgctggacaagcacctctg
ccttggtggagcaatgtgaccacctatggcgttcctttcgagctcagctggaatctccta
cataatatcgtgcggattggcttcgaaccactctcacacttggcagaatccggcgtcgat
gctttcaacaagatagcgccagaggaatgcctatcccgccttgcgtgtctagacaacacc
atcgatctagcccggttcaggcacttccaacatcaacttttggtgactcccgatgaagaa
agacggttgcttgaggagaaaggccccctccccaagtccggacgaggccagcaagccctg
gcagtggaattccagaacggtggcatcagcgccaaagcctacttcttcccaggcatgaag
tcgctggcgactggactctcgccaggaaagctcattcttgactccatcgagagcctcgct
ctcccgggattgaaggaacccgtgcatcacctctgcaactccctcggcctgcaagacgac
gggcacccaacagataccgcgattgccccgttccttctcggtgtcgacctgtgcaccccc
gagcgaagtcgcctgaaattctacgtcaccgaccaggtggtttcatgggatcgggtagcg
gacatgtggactcttcgcgggaaacgtctggaagatcctcaatgtgccgatggtctgacc
ctcctgaggaaactgtgggatctcctcgagatccctgaagggtatcggagcaacatccgg
ccggactttgcttttgggacgcctcctcccgaggactaccgacccgtcatgatggcgaac
tggaccctatctcccaagaaaaaatttccggacccccagatatacctccttaccgttgga
atgaatgacgcggtcgtaatggacgcactcgtggcgttctacgaggttctgggttggacg
gatctggccagcacatacaaggataaagtggcctcatactag

DBGET integrated database retrieval system