KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103736569
Entry
103736569         CDS       T03372                                 

Gene name
Polk
Definition
(RefSeq) DNA polymerase kappa
  KO
K03511  DNA polymerase kappa [EC:2.7.7.7]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi03460  Fanconi anemia pathway
ngi05169  Epstein-Barr virus infection
ngi05200  Pathways in cancer
ngi05202  Transcriptional misregulation in cancer
ngi05210  Colorectal cancer
ngi05212  Pancreatic cancer
ngi05213  Endometrial cancer
ngi05214  Glioma
ngi05216  Thyroid cancer
ngi05217  Basal cell carcinoma
ngi05218  Melanoma
ngi05220  Chronic myeloid leukemia
ngi05222  Small cell lung cancer
ngi05223  Non-small cell lung cancer
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    103736569 (Polk)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103736569 (Polk)
   05202 Transcriptional misregulation in cancer
    103736569 (Polk)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103736569 (Polk)
   05212 Pancreatic cancer
    103736569 (Polk)
   05225 Hepatocellular carcinoma
    103736569 (Polk)
   05226 Gastric cancer
    103736569 (Polk)
   05214 Glioma
    103736569 (Polk)
   05216 Thyroid cancer
    103736569 (Polk)
   05220 Chronic myeloid leukemia
    103736569 (Polk)
   05217 Basal cell carcinoma
    103736569 (Polk)
   05218 Melanoma
    103736569 (Polk)
   05213 Endometrial cancer
    103736569 (Polk)
   05224 Breast cancer
    103736569 (Polk)
   05222 Small cell lung cancer
    103736569 (Polk)
   05223 Non-small cell lung cancer
    103736569 (Polk)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    103736569 (Polk)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ngi03400]
    103736569 (Polk)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     103736569 (Polk)
DNA repair and recombination proteins [BR:ngi03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    103736569 (Polk)
SSDB
Motif
Pfam: IMS IMS_C IMS_HHH ATP-cone zf-C2H2_12
Other DBs
NCBI-GeneID: 103736569
NCBI-ProteinID: XP_008834298
LinkDB
Position
Un
AA seq 859 aa
MDNNTKEMNNNNKDDLLLRMGLNDNKAGMEGLDKEKINKIIMEATKGSKFYRNELKKEKQ
VNQRIENMMQQKAQITHQQLRKAQLQVDRFAMELERNRNLNNTIVHVDMDAFYAAVEMRD
NPELKDKPIAVGSMSMLSTSNYHARRFGVRAAMPGFIAKRLCPQLIIVPPNFDKYRAVSK
EVKDILAEYDPNFMAMSLDEAYLNITMHLQERQNWPEDRRRYFIKAENSVEIDKPGEEVK
KLREYECSISPLLFEDSPPDTQPPGSPFQLNSEEQNSPQILQNSVVFGISAEEVVKEIRF
RIEQKTTLTASAGIAPNTMLAKVCSDKNKPNGQYQILPSRQAVMDFIKDLPIRKVSGIGK
VTEKMLKALGIITCTELYQQRAVLSLLFSEVSWHYFLHLSLGLGSTDLERDGERKSMSVE
RTFSELSKAKDQYSLCRELCADLAQDLQKEGLKGRTVTIKLKNVNFEVKTRASTVSSAVS
TADEIFAVAKDLLRTEINADSPHPLRLRLMGVRVSAFYNEENKKQQQRSIIGFLQTGNQA
LSSTGCSLDKTDRNEFVKPLEMSHKKSFFDKKRSERIWSHQDTSKCEIVDKQSLQTSQPF
QVLKMNENLETPENSNNCQTFTCPVCFSEQGSINLEAFNKHVDTCLDEPLTSEDSKMSSC
SRASSSEAYQEENAHSSSLCEKQDCETYPKNIEVSSVDGGDLVETEDSSSKAASMNTSAN
NCSKEECCNIINKSSSPFSLENENVKILSQQESFQPRTNEVTGQALVCPVCNLEQKTSDL
TLFNVHVDICLNKGIIQELRNNEVNSVNHPKKSSRSIGCTDRVQKASGRTKRPGLRTKHS
TSKKKKPNNPRHTLDIFFK
NT seq 2580 nt   +upstreamnt  +downstreamnt
atggacaataacacaaaggagatgaataacaataacaaagatgatcttctacttaggatg
ggactaaatgataacaaagcaggaatggaaggattagataaagagaaaattaacaaaatt
ataatggaagccacaaaggggtccaaattttatagaaatgagcttaagaaggaaaagcaa
gtcaaccagcggattgaaaatatgatgcaacagaaagctcaaattacccaccagcaacta
aggaaagcacaattacaggttgacagatttgcaatggaactagaacggaaccggaatttg
aacaataccatagtgcacgttgacatggatgctttctatgcagctgtagagatgagggac
aatccagaattaaaggataaacccattgctgtggggtcaatgagtatgctgtctacttca
aattatcatgcaagaaggtttggtgttcgtgcagccatgccaggatttattgctaagaga
ctctgcccacaacttattatagtgcccccaaactttgacaaatatagagctgtgagtaaa
gaggttaaggacatacttgctgaatatgatcccaattttatggccatgagtcttgatgaa
gcctacttgaatataacaatgcacttacaagaaagacaaaattggcctgaggacagaaga
aggtatttcatcaaagcagaaaactctgtagaaattgataaaccaggagaggaagtgaag
aaactgagagagtatgaatgctccatctccccactgctttttgaagatagccctcctgat
acgcagcctccaggaagtcctttccaactgaattctgaagaacaaaacagtcctcaaata
ctccaaaattcagttgtttttggaatatcagccgaggaagtggtaaaggaaattcgcttc
agaattgaacaaaaaacaacgttaacagccagtgcaggtattgcccccaatacaatgtta
gcaaaggtgtgcagtgataagaacaaaccaaatggacaataccaaattctccccagcaga
caagcagtgatggacttcatcaaagacttaccaattaggaaggtttctggaataggaaaa
gtcacagaaaaaatgttaaaggctcttgggattattacttgcacagagctctaccaacaa
agagcagtgctttctcttcttttctctgaagtgtcttggcattacttccttcacctctcc
ctgggtctaggttcaacagacctggaaagggatggagaaaggaaaagtatgagtgttgaa
aggacgttcagtgagctgagtaaagcgaaagaccagtacagcttatgccgtgagctttgc
gctgaccttgctcaggatctccagaaagaaggacttaaggggagaactgttaccattaaa
ctgaagaatgtgaacttcgaagtcaaaactcgtgcctctacagtttcatctgctgtttct
actgcagatgaaatatttgccgttgctaaagacttgctaagaacggaaattaatgctgat
tctccacatcccttgagattaaggcttatgggtgttcgagtgtctgctttttacaatgaa
gaaaacaagaaacagcaacaaaggagcatcattggcttcttacagactggaaaccaagcc
ttgtcatccactgggtgttcactagataaaactgacagaaacgagtttgtaaaacctcta
gaaatgtctcataagaaaagtttctttgataagaagcgatcagaaaggatatggagccat
caagacacatctaagtgtgaaattgtggataaacaaagtttacagacctcacaaccattc
caagttttaaagatgaatgagaatttagaaacaccagagaattcaaataactgtcagaca
tttacttgtccagtttgctttagtgagcaaggaagcatcaatctggaagcctttaataaa
catgtagatacatgccttgatgaaccattaaccagtgaggactcaaaaatgtcctcttgt
tcacgtgcttcctcttcagaagcttatcaggaagaaaatgcacacagttcttccctttgt
gagaagcaggattgtgaaacttatcccaaaaatatagaagtctcttcagtagatggtgga
gatttggtagaaactgaagatagctcatcaaaagcagcaagtatgaacacttcagcgaat
aattgcagcaaggaggaatgttgtaatattataaacaagtcttccagtcctttttcattg
gaaaatgaaaatgtcaagatactaagtcagcaagaatccttccagcctcgtacaaatgaa
gtaacaggccaggctctagtttgtcctgtttgtaacctagaacaaaagacatcagatctt
accctgttcaacgtgcatgtagatatttgcttaaataaaggcattatccaagagctgaga
aataatgaagttaattcagttaaccaccccaaaaaaagctccagaagtataggctgcaca
gacagagtgcagaaggcttcaggaagaacaaagaggccaggactgagaacaaagcactcg
acatcaaagaaaaaaaaaccaaacaatcccagacatacccttgatatattttttaaatga

DBGET integrated database retrieval system