KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100580437
Entry
100580437         CDS       T03265                                 

Gene name
CACNA1C
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C isoform X1
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04010  MAPK signaling pathway
nle04020  Calcium signaling pathway
nle04022  cGMP-PKG signaling pathway
nle04024  cAMP signaling pathway
nle04260  Cardiac muscle contraction
nle04261  Adrenergic signaling in cardiomyocytes
nle04270  Vascular smooth muscle contraction
nle04713  Circadian entrainment
nle04720  Long-term potentiation
nle04723  Retrograde endocannabinoid signaling
nle04724  Glutamatergic synapse
nle04725  Cholinergic synapse
nle04726  Serotonergic synapse
nle04727  GABAergic synapse
nle04728  Dopaminergic synapse
nle04742  Taste transduction
nle04911  Insulin secretion
nle04912  GnRH signaling pathway
nle04921  Oxytocin signaling pathway
nle04924  Renin secretion
nle04925  Aldosterone synthesis and secretion
nle04927  Cortisol synthesis and secretion
nle04929  GnRH secretion
nle04930  Type II diabetes mellitus
nle04934  Cushing syndrome
nle04935  Growth hormone synthesis, secretion and action
nle05010  Alzheimer disease
nle05020  Prion disease
nle05022  Pathways of neurodegeneration - multiple diseases
nle05031  Amphetamine addiction
nle05410  Hypertrophic cardiomyopathy
nle05412  Arrhythmogenic right ventricular cardiomyopathy
nle05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100580437 (CACNA1C)
   04020 Calcium signaling pathway
    100580437 (CACNA1C)
   04024 cAMP signaling pathway
    100580437 (CACNA1C)
   04022 cGMP-PKG signaling pathway
    100580437 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100580437 (CACNA1C)
   04929 GnRH secretion
    100580437 (CACNA1C)
   04912 GnRH signaling pathway
    100580437 (CACNA1C)
   04921 Oxytocin signaling pathway
    100580437 (CACNA1C)
   04935 Growth hormone synthesis, secretion and action
    100580437 (CACNA1C)
   04924 Renin secretion
    100580437 (CACNA1C)
   04925 Aldosterone synthesis and secretion
    100580437 (CACNA1C)
   04927 Cortisol synthesis and secretion
    100580437 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100580437 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    100580437 (CACNA1C)
   04270 Vascular smooth muscle contraction
    100580437 (CACNA1C)
  09156 Nervous system
   04724 Glutamatergic synapse
    100580437 (CACNA1C)
   04727 GABAergic synapse
    100580437 (CACNA1C)
   04725 Cholinergic synapse
    100580437 (CACNA1C)
   04728 Dopaminergic synapse
    100580437 (CACNA1C)
   04726 Serotonergic synapse
    100580437 (CACNA1C)
   04720 Long-term potentiation
    100580437 (CACNA1C)
   04723 Retrograde endocannabinoid signaling
    100580437 (CACNA1C)
  09157 Sensory system
   04742 Taste transduction
    100580437 (CACNA1C)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100580437 (CACNA1C)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100580437 (CACNA1C)
   05020 Prion disease
    100580437 (CACNA1C)
   05022 Pathways of neurodegeneration - multiple diseases
    100580437 (CACNA1C)
  09165 Substance dependence
   05031 Amphetamine addiction
    100580437 (CACNA1C)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100580437 (CACNA1C)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100580437 (CACNA1C)
   05414 Dilated cardiomyopathy
    100580437 (CACNA1C)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100580437 (CACNA1C)
   04934 Cushing syndrome
    100580437 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:nle04040]
    100580437 (CACNA1C)
Ion channels [BR:nle04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100580437 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel DUF4834
Other DBs
NCBI-GeneID: 100580437
NCBI-ProteinID: XP_030660370
Ensembl: ENSNLEG00000002735
LinkDB
Position
23
AA seq 2135 aa
MVNENTRMYIPEENHQGSNYGSARPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAAR
QAKLMGSAGNATISTVSSTQRKRQQYGKPKKQGSTTATRPPRALLCLTLKNPIRRACISI
VEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFR
VLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYN
QEGIAAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCITME
GWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQK
LREKQQLEEDLKGYLDWITQAEDIDPENEDEGMDEEKPRNMSMPTSETESVNTENVAGGD
IEGENCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIAS
EHYNQPHWLTEVQDTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFVVCGGILET
ILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFII
IFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPS
FPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLARTAS
PEKKQELMEKPAVEESKEEKIELKSITADGESPPTTKINMDDLQPNENEDKSPYPNPETT
GEEDEEEPEMPVGPRPRPLSELHLKEKAVPMPEASAFFIFSSNNRFRLQCHRIVNDTIFT
NLILFFILLSSISLAAEDPVQHTSFRNHILGNADYVFTSIFTLEIILKMTAYGAFLHKGS
FCRNYFNILDLLVVSVSLISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVF
VAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYTCSDSSKQTEAECKGNYITYKDGEVDH
PIIQPRSWENSKFDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEIS
IFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYI
PKNQHQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQSCLFKIAMNILNMLFTGLFT
VEMILKLIAFKPKHYFCDAWNTFDALIVVGSIVDIAITEVNPAEHTQCSPSMNAEENSRI
SITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFG
KIALNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGKKCAPESEPSNSTEG
ETPCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAE
YDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLF
ALVRTALRIKTEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFL
IQEYFRKFKKRKEQGLVGKPSQRNALSLQAGLRTLHDIGPEIRRAISGDLTAEEELDKAM
KEAVSAASEDDIFRRAGGLFGNHVSYYQSDGRSAFPQTFTTQRPLHINKAGSSQGDTESP
SHEKLVDSTFTPSSYSSTGSNANINNANNTALGRLPRPAGYPSTVSTVEGHGPPLSPAIR
VQEVAWKLSSSRCHSQESQAAMAGQEETSQDETYEVKMNHDTEACSEPSLLSTEMLSYQD
DENRQLTLPEEDKRDIQQSPKRGFLHSASLGRRASFHLECLKRQKDRGGDISQKTVLPLH
LVHHQALAVAGLSPLLQRSHSPASFPRPFATPPATPGSRGWPPQPVPTLRLEGVESSEKL
NSSFPSIHCGSWAETTPGGGGSSAARRARPVSLMVPSQAGAPGRQFHGSASSLVEAVLIS
EGLGQFAQDPKFIEVTTQELADACDMTIEEMESAADNILSGGAPQSPNGALLPFVNCRDA
GQDRAGGEEDAGCARARGRLSEEELQDSRVYVSSL
NT seq 6408 nt   +upstreamnt  +downstreamnt
atggtcaatgagaatacgaggatgtacattccagaggaaaaccaccaaggttccaactat
gggagcgcacgccccgcccatgccaacatgaatgccaatgcggcagcggggctggcccct
gaacacatccccaccccgggggccgccctgtcctggcaggcggccatcgacgcagcccgg
caggctaagctgatgggcagcgctggcaatgcgaccatctccacagtcagctccacgcag
cggaagcggcagcaatatgggaaacccaagaagcagggcagcaccacggccacacgcccg
ccccgagccctgctctgcctgaccctgaagaaccccatccggagggcctgcatcagcatt
gtcgaatggaaaccatttgaaataattattttactgactatttttgccaattgtgtggcc
ttagcgatctatattccctttccagaagatgattccaacgccaccaattccaacctggaa
cgagtggaatatctctttctcataatttttacggtggaagcgtttttaaaagtcatcgcc
tatggactcctctttcaccccaatgcctacctccgcaacggctggaacctactagatttt
ataattgtggttgtggggctttttagtgcaattttagaacaagcaaccaaagcagacggg
gcaaacgctctcggagggaaaggggccggatttgatgtgaaggcgctgagggccttccgc
gtgctgcgccccctgcggctggtgtccggagtcccaagtctccaggtggtcctgaattcc
atcatcaaggccatggtccccctgctgcacatcgccctgcttgtgctgtttgtcatcatc
atctacgccatcatcggcctggagctcttcatggggaagatgcacaagacctgctacaac
caggagggcatagcagcagaagatgacccttccccttgtgcactggaaacaggccacggg
cggcagtgccagaacggcacggtgtgcaagcccggctgggatgggcccaagcacggcatc
accaactttgacaactttgccttcgccatgctcacggtgttccagtgcatcaccatggag
ggctggacggacgtgctgtactggatgcaggacgctatgggctatgagttaccctgggtg
tattttgtcagtctggtcatctttggatcctttttcgttctaaatctggttctcggtgtg
ttgagcggagagttttccaaagagagggagaaggccaaggcccggggagatttccagaag
ctgcgggagaagcagcagctagaagaggatctcaaaggctacctggactggatcactcag
gccgaagacatcgatcctgagaacgaggacgagggcatggatgaggagaagccccgaaac
atgagcatgcccaccagtgagaccgagtccgtcaacaccgaaaacgtggctggaggtgac
atcgagggagaaaactgcggggccaggctggcccaccggatctccaagtcaaagttcagc
cgctactggcgccggtggaatcggttctgcagaagaaagtgccgcgccgcagtcaagtct
aatgtcttctactggctggtgattttcctggtgttcctcaacacgctcaccattgcctct
gagcactacaaccagccccactggctcaccgaagtccaagacacggcgaacaaggccctg
ctggccctgttcacagcggagatgctcctgaagatgtacagcctgggcctgcaggcctat
ttcgtgtccctcttcaaccgctttgactgcttcgtcgtgtgtggcggcatcctggagacc
atcctggtggagaccaagatcatgtccccactgggcatctccgtgctcagatgtgtccgg
ctgctgaggatattcaagatcacgaggtactggaactccttgagcaacctggtggcatcc
ttgctgaactctgtgcgctccatcgcctccctgctccttctcctcttcctcttcatcatc
atcttctccctcctggggatgcagctctttggaggaaagttcaactttgatgagatgcag
acccggaggagcacatttgataacttcccccagtccctcctcactgtgtttcagatcctg
accggggaggactggaattcggtgatgtatgatgggatcatggcttatggcggcccctct
tttccagggatgttagtctgtatttacttcatcatcctcttcatctgtggaaactatatc
ctactgaatgtgttcttggccattgctgtggacaacctggctgatgctgagagcctcaca
tctgcccaaaaggaggaggaagaggagaaggagagaaagaagctggccaggactgccagc
ccagagaagaaacaagagttgatggagaagccggcagtggaggaatccaaggaggagaag
attgagctgaaatccatcacggctgacggagagtctccacccaccaccaagatcaacatg
gatgacctccagcccaatgaaaatgaggataagagcccctaccccaacccagaaactaca
ggagaagaggatgaggaggagccagagatgcctgtcggccctcgcccacgaccactctct
gagcttcaccttaaggaaaaagcagtgcccatgccagaagccagcgcatttttcatcttc
agctctaacaacaggtttcgcctccagtgccaccgcattgtcaatgacacgatcttcacc
aacctgatcctcttcttcattctgctcagcagcatttccctggctgctgaggacccggtc
cagcacacctccttcaggaaccatatcctaggcaatgcagactatgtcttcactagtatc
tttacattagaaattatccttaagatgactgcttatggggctttcctgcacaagggctct
ttctgccgtaactacttcaacatcctggacctgctggtggtcagcgtgtccctcatctcc
tttggcatccagtccagtgcaatcaatgtcgtgaagatcttgcgagtcctgcgagtactc
aggcccctgagggccatcaacagggccaaggggctaaagcatgtggttcagtgtgtgttt
gtcgccatccggaccatcgggaacatcgtgattgtcaccaccctgctgcagttcatgttt
gcctgcattggggtccagctcttcaagggaaagctgtacacctgttcagacagttccaag
cagacagaggcggaatgcaagggcaactacatcacgtacaaagacggggaggttgaccac
cccatcatccaaccccgcagctgggagaacagcaagtttgactttgacaatgttctggca
gccatgatggctctcttcactgtctccaccttcgaagggtggccagagctgctgtaccgc
tccatcgactcccacacggaagacaagggccccatctacaactaccgcgtggagatctcc
atcttcttcatcatctacatcatcatcatcgccttcttcatgatgaacatcttcgtgggc
ttcgtcatcgtcaccttccaggagcagggggagcaggagtacaagaactgtgagctggac
aagaaccagcgacagtgcgtggaatacgccctcaaggcccggcccctgcggaggtacatc
cccaagaaccagcaccagtacaaagtgtggtacgtggtcaactccacctacttcgagtac
ctgatgttcgtcctcatcctgctcaacaccatctgcctggccatgcagcactacggccag
agctgcctgttcaaaattgccatgaacatcctcaacatgctcttcactggcctcttcacc
gtggagatgatcctgaagctcattgccttcaaacccaagcactatttctgtgatgcatgg
aatacatttgatgccttgattgttgtgggtagcattgttgatatagcaatcaccgaggta
aacccagctgaacatacccaatgctctccctctatgaacgcagaggaaaactcccgcatc
tccatcaccttcttccgcctgttccgggtcatgcgcctggtgaagctgctgagccgtggg
gagggcatccggacgctgctgtggaccttcatcaagtccttccaggccctgccctatgtg
gccctcctgatcgtgatgctattcttcatctacgcggtgatcgggatgcaggtgtttggg
aaaattgccctgaatgataccacagagatcaaccggaacaacaactttcagaccttcccc
caggccgtgctgctcctcttcaggtgtgccactggggaggcctggcaggacatcatgctg
gcctgcatgccaggcaagaagtgtgccccggagtctgagcccagcaacagcacggagggt
gaaacgccctgtggcagcagctttgctgtcttctacttcatcagcttctatatgctctgt
gccttcctgatcatcaacctctttgtagctgtcatcatggacaactttgactacctgaca
agggactggtccatccttggtccccaccacctggatgagtttaaaagaatctgggcagag
tatgaccctgaagccaagggtcgtatcaaacacctggatgtggtgaccctcctccggcgg
attcagcccccactaggttttgggaagctgtgccctcaccgcgtggcttgcaaacgcctg
gtctccatgaacatgcctctgaacagcgacgggacagtcatgttcaatgccaccctgttt
gccctggtcaggacggccctgaggatcaaaacagaagggaacctagaacaagccaatgag
gagctgcgggcgatcatcaagaagatctggaagcggaccagcatgaagctgctggaccag
gtggtgccccctgcaggtgatgatgaggtcaccgttggcaagttctatgccaccttcctg
atccaggagtacttccggaagttcaagaagcgcaaagagcagggccttgtgggcaagccc
tcccagaggaacgcactgtctctgcaggctggcttgcgcacgctgcatgacatcgggcct
gagatccgacgggccatctctggagatctcaccgctgaggaagagctggacaaggccatg
aaggaggctgtgtccgctgcttctgaagatgacatcttcaggcgggccggtggcctgttc
ggcaaccacgtcagctactaccaaagcgacggccggagcgccttcccccagaccttcacc
actcagcgcccgctgcacatcaacaaggcgggcagcagccagggtgacactgagtcgccg
tcccacgagaagctggtggactccaccttcacccccagcagctactcgtccaccggctcc
aacgccaacatcaacaacgctaacaacactgccctgggtcgcctccctcgccctgccggc
taccccagcacagtcagcactgtggagggccatgggccccccttgtcccctgccatccgg
gtgcaggaggtggcgtggaagctcagctccagcaggtgccattcccaggagagccaggca
gccatggcgggtcaggaggagacgtctcaggatgagacctatgaagtgaagatgaaccat
gacacggaggcctgcagtgagcccagcctgctctccacagagatgctctcctaccaggat
gacgaaaatcggcaactgacgctcccagaggaggacaagagggacatccagcaatctccg
aagaggggtttcctccactctgcctcactaggtcgaagggcctccttccacctggaatgt
ctgaagcgacagaaggaccgagggggagacatctctcagaagacagtcctgcccttgcat
ctggttcatcatcaggcattggcagtggcaggcctgagccccctcctccagagaagccat
tcccctgcctcattccccaggccttttgccaccccaccagccacacctggcagccgaggc
tggcccccacagcccgtccccaccctgcggctggagggggtcgagtccagtgagaaactc
aacagcagcttcccatccatccactgcggctcctgggctgagaccacccccggtggcggg
ggcagcagcgccgcccggagagcccggcccgtctccctcatggtgcccagccaggctggg
gccccagggaggcagttccacggcagtgccagcagcctggtggaagcggtcttgatttca
gaaggactggggcagtttgctcaagatcccaagttcatcgaggtcaccacccaggagctg
gccgacgcctgcgacatgaccatagaggagatggagagcgcggccgacaacatcctcagc
gggggcgccccacagagccccaatggcgccctcttaccctttgtgaactgcagggacgcg
gggcaggaccgagccgggggcgaagaggacgcgggctgtgcgcgcgcgcgggggcggctg
agcgaggaggagctccaggacagcagggtgtacgtcagcagcctgtag

DBGET integrated database retrieval system