KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100580872
Entry
100580872         CDS       T03265                                 

Gene name
PIK3CD
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform isoform X1
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle00562  Inositol phosphate metabolism
nle01100  Metabolic pathways
nle01521  EGFR tyrosine kinase inhibitor resistance
nle01522  Endocrine resistance
nle01524  Platinum drug resistance
nle04012  ErbB signaling pathway
nle04014  Ras signaling pathway
nle04015  Rap1 signaling pathway
nle04024  cAMP signaling pathway
nle04062  Chemokine signaling pathway
nle04066  HIF-1 signaling pathway
nle04068  FoxO signaling pathway
nle04070  Phosphatidylinositol signaling system
nle04071  Sphingolipid signaling pathway
nle04072  Phospholipase D signaling pathway
nle04140  Autophagy - animal
nle04150  mTOR signaling pathway
nle04151  PI3K-Akt signaling pathway
nle04152  AMPK signaling pathway
nle04210  Apoptosis
nle04211  Longevity regulating pathway
nle04213  Longevity regulating pathway - multiple species
nle04218  Cellular senescence
nle04360  Axon guidance
nle04370  VEGF signaling pathway
nle04380  Osteoclast differentiation
nle04510  Focal adhesion
nle04550  Signaling pathways regulating pluripotency of stem cells
nle04611  Platelet activation
nle04613  Neutrophil extracellular trap formation
nle04620  Toll-like receptor signaling pathway
nle04625  C-type lectin receptor signaling pathway
nle04630  JAK-STAT signaling pathway
nle04650  Natural killer cell mediated cytotoxicity
nle04660  T cell receptor signaling pathway
nle04662  B cell receptor signaling pathway
nle04664  Fc epsilon RI signaling pathway
nle04666  Fc gamma R-mediated phagocytosis
nle04668  TNF signaling pathway
nle04670  Leukocyte transendothelial migration
nle04722  Neurotrophin signaling pathway
nle04725  Cholinergic synapse
nle04750  Inflammatory mediator regulation of TRP channels
nle04810  Regulation of actin cytoskeleton
nle04910  Insulin signaling pathway
nle04914  Progesterone-mediated oocyte maturation
nle04915  Estrogen signaling pathway
nle04917  Prolactin signaling pathway
nle04919  Thyroid hormone signaling pathway
nle04923  Regulation of lipolysis in adipocytes
nle04926  Relaxin signaling pathway
nle04929  GnRH secretion
nle04930  Type II diabetes mellitus
nle04931  Insulin resistance
nle04932  Non-alcoholic fatty liver disease
nle04933  AGE-RAGE signaling pathway in diabetic complications
nle04935  Growth hormone synthesis, secretion and action
nle04960  Aldosterone-regulated sodium reabsorption
nle04973  Carbohydrate digestion and absorption
nle05010  Alzheimer disease
nle05017  Spinocerebellar ataxia
nle05020  Prion disease
nle05100  Bacterial invasion of epithelial cells
nle05132  Salmonella infection
nle05135  Yersinia infection
nle05142  Chagas disease
nle05146  Amoebiasis
nle05160  Hepatitis C
nle05161  Hepatitis B
nle05162  Measles
nle05163  Human cytomegalovirus infection
nle05164  Influenza A
nle05165  Human papillomavirus infection
nle05166  Human T-cell leukemia virus 1 infection
nle05167  Kaposi sarcoma-associated herpesvirus infection
nle05168  Herpes simplex virus 1 infection
nle05169  Epstein-Barr virus infection
nle05170  Human immunodeficiency virus 1 infection
nle05171  Coronavirus disease - COVID-19
nle05200  Pathways in cancer
nle05203  Viral carcinogenesis
nle05205  Proteoglycans in cancer
nle05206  MicroRNAs in cancer
nle05210  Colorectal cancer
nle05211  Renal cell carcinoma
nle05212  Pancreatic cancer
nle05213  Endometrial cancer
nle05214  Glioma
nle05215  Prostate cancer
nle05218  Melanoma
nle05220  Chronic myeloid leukemia
nle05221  Acute myeloid leukemia
nle05222  Small cell lung cancer
nle05223  Non-small cell lung cancer
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
nle05230  Central carbon metabolism in cancer
nle05231  Choline metabolism in cancer
nle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
nle05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:nle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100580872 (PIK3CD)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100580872 (PIK3CD)
   04014 Ras signaling pathway
    100580872 (PIK3CD)
   04015 Rap1 signaling pathway
    100580872 (PIK3CD)
   04370 VEGF signaling pathway
    100580872 (PIK3CD)
   04630 JAK-STAT signaling pathway
    100580872 (PIK3CD)
   04668 TNF signaling pathway
    100580872 (PIK3CD)
   04066 HIF-1 signaling pathway
    100580872 (PIK3CD)
   04068 FoxO signaling pathway
    100580872 (PIK3CD)
   04070 Phosphatidylinositol signaling system
    100580872 (PIK3CD)
   04072 Phospholipase D signaling pathway
    100580872 (PIK3CD)
   04071 Sphingolipid signaling pathway
    100580872 (PIK3CD)
   04024 cAMP signaling pathway
    100580872 (PIK3CD)
   04151 PI3K-Akt signaling pathway
    100580872 (PIK3CD)
   04152 AMPK signaling pathway
    100580872 (PIK3CD)
   04150 mTOR signaling pathway
    100580872 (PIK3CD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100580872 (PIK3CD)
  09143 Cell growth and death
   04210 Apoptosis
    100580872 (PIK3CD)
   04218 Cellular senescence
    100580872 (PIK3CD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100580872 (PIK3CD)
   04550 Signaling pathways regulating pluripotency of stem cells
    100580872 (PIK3CD)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100580872 (PIK3CD)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100580872 (PIK3CD)
   04613 Neutrophil extracellular trap formation
    100580872 (PIK3CD)
   04620 Toll-like receptor signaling pathway
    100580872 (PIK3CD)
   04625 C-type lectin receptor signaling pathway
    100580872 (PIK3CD)
   04650 Natural killer cell mediated cytotoxicity
    100580872 (PIK3CD)
   04660 T cell receptor signaling pathway
    100580872 (PIK3CD)
   04662 B cell receptor signaling pathway
    100580872 (PIK3CD)
   04664 Fc epsilon RI signaling pathway
    100580872 (PIK3CD)
   04666 Fc gamma R-mediated phagocytosis
    100580872 (PIK3CD)
   04670 Leukocyte transendothelial migration
    100580872 (PIK3CD)
   04062 Chemokine signaling pathway
    100580872 (PIK3CD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100580872 (PIK3CD)
   04923 Regulation of lipolysis in adipocytes
    100580872 (PIK3CD)
   04929 GnRH secretion
    100580872 (PIK3CD)
   04915 Estrogen signaling pathway
    100580872 (PIK3CD)
   04914 Progesterone-mediated oocyte maturation
    100580872 (PIK3CD)
   04917 Prolactin signaling pathway
    100580872 (PIK3CD)
   04926 Relaxin signaling pathway
    100580872 (PIK3CD)
   04935 Growth hormone synthesis, secretion and action
    100580872 (PIK3CD)
   04919 Thyroid hormone signaling pathway
    100580872 (PIK3CD)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100580872 (PIK3CD)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100580872 (PIK3CD)
  09156 Nervous system
   04725 Cholinergic synapse
    100580872 (PIK3CD)
   04722 Neurotrophin signaling pathway
    100580872 (PIK3CD)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100580872 (PIK3CD)
  09158 Development and regeneration
   04360 Axon guidance
    100580872 (PIK3CD)
   04380 Osteoclast differentiation
    100580872 (PIK3CD)
  09149 Aging
   04211 Longevity regulating pathway
    100580872 (PIK3CD)
   04213 Longevity regulating pathway - multiple species
    100580872 (PIK3CD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100580872 (PIK3CD)
   05206 MicroRNAs in cancer
    100580872 (PIK3CD)
   05205 Proteoglycans in cancer
    100580872 (PIK3CD)
   05203 Viral carcinogenesis
    100580872 (PIK3CD)
   05230 Central carbon metabolism in cancer
    100580872 (PIK3CD)
   05231 Choline metabolism in cancer
    100580872 (PIK3CD)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100580872 (PIK3CD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100580872 (PIK3CD)
   05212 Pancreatic cancer
    100580872 (PIK3CD)
   05225 Hepatocellular carcinoma
    100580872 (PIK3CD)
   05226 Gastric cancer
    100580872 (PIK3CD)
   05214 Glioma
    100580872 (PIK3CD)
   05221 Acute myeloid leukemia
    100580872 (PIK3CD)
   05220 Chronic myeloid leukemia
    100580872 (PIK3CD)
   05218 Melanoma
    100580872 (PIK3CD)
   05211 Renal cell carcinoma
    100580872 (PIK3CD)
   05215 Prostate cancer
    100580872 (PIK3CD)
   05213 Endometrial cancer
    100580872 (PIK3CD)
   05224 Breast cancer
    100580872 (PIK3CD)
   05222 Small cell lung cancer
    100580872 (PIK3CD)
   05223 Non-small cell lung cancer
    100580872 (PIK3CD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100580872 (PIK3CD)
   05017 Spinocerebellar ataxia
    100580872 (PIK3CD)
   05020 Prion disease
    100580872 (PIK3CD)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100580872 (PIK3CD)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100580872 (PIK3CD)
   04932 Non-alcoholic fatty liver disease
    100580872 (PIK3CD)
   04931 Insulin resistance
    100580872 (PIK3CD)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100580872 (PIK3CD)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100580872 (PIK3CD)
   05135 Yersinia infection
    100580872 (PIK3CD)
   05100 Bacterial invasion of epithelial cells
    100580872 (PIK3CD)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100580872 (PIK3CD)
   05170 Human immunodeficiency virus 1 infection
    100580872 (PIK3CD)
   05161 Hepatitis B
    100580872 (PIK3CD)
   05160 Hepatitis C
    100580872 (PIK3CD)
   05171 Coronavirus disease - COVID-19
    100580872 (PIK3CD)
   05164 Influenza A
    100580872 (PIK3CD)
   05162 Measles
    100580872 (PIK3CD)
   05168 Herpes simplex virus 1 infection
    100580872 (PIK3CD)
   05163 Human cytomegalovirus infection
    100580872 (PIK3CD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100580872 (PIK3CD)
   05169 Epstein-Barr virus infection
    100580872 (PIK3CD)
   05165 Human papillomavirus infection
    100580872 (PIK3CD)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100580872 (PIK3CD)
   05142 Chagas disease
    100580872 (PIK3CD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100580872 (PIK3CD)
   01524 Platinum drug resistance
    100580872 (PIK3CD)
   01522 Endocrine resistance
    100580872 (PIK3CD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nle04131]
    100580872 (PIK3CD)
Enzymes [BR:nle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100580872 (PIK3CD)
Membrane trafficking [BR:nle04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100580872 (PIK3CD)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_rbd PI3K_C2
Other DBs
NCBI-GeneID: 100580872
NCBI-ProteinID: XP_030661447
Ensembl: ENSNLEG00000009299
LinkDB
Position
24
AA seq 1044 aa
MPPGVDCPMEFWTKEENQSVVVDFLLPTGVYLNFPVSRNANLSTIKQLLWHRAQYEPLFH
MLSGPEAYVFTCINQTAEQQELEDEQRRLCDVQPFLPVLRLVAREGDRVKKLINSQISLL
IGKGLHEFDSLCDPEVNDFRAKMCQFCEEAAARRQQLGWEAWLQYSFPLQLEPSARTWGP
GTLRLPNRALLVNVKFEGSEESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYT
LQVNGRHEYLYGSYPLCQFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNPAPQVQKPR
AKPPPIPGKKPSSVSLWSLEQPFCIELIQGSKVNADERMKLVVQAGLFHGNEMLCKTVSS
SEVSVCSEPVWKQRLEFDINICDLPRMARLCFALYAVIEKAKKARSTKKKSKKADCPIAW
ANLMLFDYKDQLKTGERCLYMWPSVPDEKGELLNPTGTVRSNPNTDSAAALLICLPEVAP
HPVYYPALEKILELGRHSECVHVTEEEQLQLREILERRGSGELYEHEKDLVWKLRHEVQE
HFPEALARLLLVTKWNRHEDVAQMLYLLCSWPELPVLSALELLDFSFPDCHVGSFAIKSL
RKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLDRALANRKIGHFLFWHLRSEMHVPSV
ALRFGLILEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKLSSQKTPKPQTKELMHLCMR
QEAYLEALSHLQSPLDPSTLLAEVCVEQCTFMDSKMKPLWIMYSNEEAGSGGSVGIIFKN
GDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLPTGDRTGLIEVVLRSDTIANIQLN
KSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIM
IRESGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFRGYC
ERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFN
EALRESWKTKVNWLAHNVSKDNRQ
NT seq 3135 nt   +upstreamnt  +downstreamnt
atgccccctggggtggactgccccatggaattctggaccaaggaggagaatcagagcgtc
gtggttgacttcctgctgcccacaggggtctacctgaacttccctgtgtcccgcaatgcc
aacctcagcaccatcaagcagctgctgtggcaccgcgcccagtatgagccgctcttccac
atgctcagtggccccgaggcctatgtgttcacctgcatcaaccagacagcggagcagcag
gagctggaggacgagcaaaggcgtctgtgtgacgtgcagcccttcctgcccgtcctgcgc
ctggtggcccgcgagggcgaccgcgtgaagaagctcatcaactcacagatcagcctcctc
atcggcaaaggcctccacgagtttgactccttgtgcgacccagaagtgaacgactttcgc
gccaagatgtgccaattctgcgaggaggcggccgctcgccggcagcagctgggctgggag
gcctggctgcagtacagtttccccctgcagctggagccctcggctcgaacctgggggcct
ggcaccctgcggctcccgaaccgggcccttctggtcaacgttaagtttgaaggcagcgag
gagagcttcaccttccaggtgtctaccaaggacgtgccgctggcgctgatggcctgtgcc
ctgcggaagaaggccacggtgttccggcagccgctggtggagcagccggaggactacacg
ctgcaggtgaacggcaggcatgagtacctgtacggcagctacccactctgccagttccag
tacatctgcagctgcctgcacagtgggctgacccctcacctgaccatggtccattcctcc
tccatcctcgccatgcgggatgagcagagcaaccctgccccccaggtccagaaaccgcgt
gccaaaccacctcccattcctgggaagaagccttcctctgtgtccctgtggtccctggag
cagccgttctgcatcgagctcatccagggcagcaaagtgaacgccgacgagcggatgaag
ctggtggtgcaggccgggcttttccacggcaacgagatgctgtgcaagacggtgtccagc
tcggaggtgagtgtgtgctcggagcccgtgtggaagcagcggctggagttcgacatcaac
atctgcgacctgccccgcatggcccgtctctgctttgcgctgtacgccgtgatcgagaaa
gccaagaaggctcgctccaccaagaagaagtccaagaaggcggactgccccattgcctgg
gccaacctcatgctgtttgactacaaggaccagcttaagaccggggaacgctgcctctac
atgtggccctccgtcccagatgagaagggcgagctgctgaaccccacgggtactgtgcgc
agtaaccccaacacggatagcgccgccgccctgctcatctgcctgcccgaggtggccccg
caccccgtgtactatcccgccctggagaagatcttggagctggggcggcacagcgagtgt
gtgcatgtcactgaggaggagcagctgcagctgcgggaaattctggagcggcgggggtct
ggggagctgtatgagcacgagaaggacctggtgtggaagctgcggcatgaagtccaggag
cacttcccggaggcgctggcccggctgctgctggtcactaagtggaacaggcatgaggat
gtggcccagatgctctacctgctgtgctcctggccggagctgcccgtcctgagcgccctg
gagctgctagacttcagcttccctgattgccacgtaggctccttcgccatcaagtcgctg
cggaaactgacggacgatgagctgttccagtacctgctgcagctggtgcaggtgctcaag
tacgagtcctacctggactgcgagctgaccaaattcctgctggaccgggccctggccaac
cgcaagatcggccacttccttttctggcacctccgctccgagatgcacgtgccgtccgtg
gccctgcgcttcggcctcatcctggaggcctactgcaggggcagcacccaccacatgaag
gtgctgatgaagcagggggaagcactgagcaaactgaaggccctgaatgacttcgtcaag
ctgagctctcagaagacccctaagccccagaccaaggagctgatgcacttgtgcatgcgg
caggaggcctacctagaggccctctcccacttgcagtccccactcgaccccagcaccctg
ctggctgaagtctgcgtggagcagtgcaccttcatggactccaagatgaagcccctgtgg
atcatgtacagcaacgaggaggcaggcagcggcggcagcgtgggcatcatcttcaagaat
ggggatgacctccggcaggacatgttgaccctgcagatgatccagctcatggacgtcctg
tggaagcaggaggggctggacctgaggatgaccccctacggctgcctccccaccggggac
cgcacaggtctcatcgaggtggtactccgctccgacaccatcgccaacatccaacttaac
aagagcaacatggcagccacagccgccttcaacaaggacgccctgctcaactggctgaag
tccaagaacccgggggaggccctggatcgagccattgaggagttcaccctctcctgtgct
ggctactgtgtggccacatacgtgctgggcatcggcgatcggcacagcgacaacatcatg
atccgagagagtgggcagctgttccacattgattttggccactttctggggaatttcaag
accaagtttggaatcaaccgcgagcgtgtcccattcatcctcacctatgactttgtccat
gtgattcagcaggggaagactaataatagtgagaaatttgaacgcttccggggctactgt
gaaagggcctacaccatcctgcggcgccacgggcttctcttcctccacctctttgccctg
atgcgggcggcaggccttcctgagctcagctgctccaaagacatccagtatctcaaggac
tccctggcactggggaaaacagaggaggaggcgctgaagcacttccgagtgaagtttaac
gaagccctccgtgagagctggaaaaccaaagtgaactggctggcccacaacgtgtccaaa
gacaacaggcagtag

KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100584384
Entry
100584384         CDS       T03265                                 

Gene name
PIK3CB
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform isoform X1
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle00562  Inositol phosphate metabolism
nle01100  Metabolic pathways
nle01521  EGFR tyrosine kinase inhibitor resistance
nle01522  Endocrine resistance
nle01524  Platinum drug resistance
nle04012  ErbB signaling pathway
nle04014  Ras signaling pathway
nle04015  Rap1 signaling pathway
nle04024  cAMP signaling pathway
nle04062  Chemokine signaling pathway
nle04066  HIF-1 signaling pathway
nle04068  FoxO signaling pathway
nle04070  Phosphatidylinositol signaling system
nle04071  Sphingolipid signaling pathway
nle04072  Phospholipase D signaling pathway
nle04140  Autophagy - animal
nle04150  mTOR signaling pathway
nle04151  PI3K-Akt signaling pathway
nle04152  AMPK signaling pathway
nle04210  Apoptosis
nle04211  Longevity regulating pathway
nle04213  Longevity regulating pathway - multiple species
nle04218  Cellular senescence
nle04360  Axon guidance
nle04370  VEGF signaling pathway
nle04380  Osteoclast differentiation
nle04510  Focal adhesion
nle04550  Signaling pathways regulating pluripotency of stem cells
nle04611  Platelet activation
nle04613  Neutrophil extracellular trap formation
nle04620  Toll-like receptor signaling pathway
nle04625  C-type lectin receptor signaling pathway
nle04630  JAK-STAT signaling pathway
nle04650  Natural killer cell mediated cytotoxicity
nle04660  T cell receptor signaling pathway
nle04662  B cell receptor signaling pathway
nle04664  Fc epsilon RI signaling pathway
nle04666  Fc gamma R-mediated phagocytosis
nle04668  TNF signaling pathway
nle04670  Leukocyte transendothelial migration
nle04722  Neurotrophin signaling pathway
nle04725  Cholinergic synapse
nle04750  Inflammatory mediator regulation of TRP channels
nle04810  Regulation of actin cytoskeleton
nle04910  Insulin signaling pathway
nle04914  Progesterone-mediated oocyte maturation
nle04915  Estrogen signaling pathway
nle04917  Prolactin signaling pathway
nle04919  Thyroid hormone signaling pathway
nle04923  Regulation of lipolysis in adipocytes
nle04926  Relaxin signaling pathway
nle04929  GnRH secretion
nle04930  Type II diabetes mellitus
nle04931  Insulin resistance
nle04932  Non-alcoholic fatty liver disease
nle04933  AGE-RAGE signaling pathway in diabetic complications
nle04935  Growth hormone synthesis, secretion and action
nle04960  Aldosterone-regulated sodium reabsorption
nle04973  Carbohydrate digestion and absorption
nle05010  Alzheimer disease
nle05017  Spinocerebellar ataxia
nle05020  Prion disease
nle05100  Bacterial invasion of epithelial cells
nle05132  Salmonella infection
nle05135  Yersinia infection
nle05142  Chagas disease
nle05146  Amoebiasis
nle05160  Hepatitis C
nle05161  Hepatitis B
nle05162  Measles
nle05163  Human cytomegalovirus infection
nle05164  Influenza A
nle05165  Human papillomavirus infection
nle05166  Human T-cell leukemia virus 1 infection
nle05167  Kaposi sarcoma-associated herpesvirus infection
nle05168  Herpes simplex virus 1 infection
nle05169  Epstein-Barr virus infection
nle05170  Human immunodeficiency virus 1 infection
nle05171  Coronavirus disease - COVID-19
nle05200  Pathways in cancer
nle05203  Viral carcinogenesis
nle05205  Proteoglycans in cancer
nle05206  MicroRNAs in cancer
nle05210  Colorectal cancer
nle05211  Renal cell carcinoma
nle05212  Pancreatic cancer
nle05213  Endometrial cancer
nle05214  Glioma
nle05215  Prostate cancer
nle05218  Melanoma
nle05220  Chronic myeloid leukemia
nle05221  Acute myeloid leukemia
nle05222  Small cell lung cancer
nle05223  Non-small cell lung cancer
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
nle05230  Central carbon metabolism in cancer
nle05231  Choline metabolism in cancer
nle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
nle05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:nle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100584384 (PIK3CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100584384 (PIK3CB)
   04014 Ras signaling pathway
    100584384 (PIK3CB)
   04015 Rap1 signaling pathway
    100584384 (PIK3CB)
   04370 VEGF signaling pathway
    100584384 (PIK3CB)
   04630 JAK-STAT signaling pathway
    100584384 (PIK3CB)
   04668 TNF signaling pathway
    100584384 (PIK3CB)
   04066 HIF-1 signaling pathway
    100584384 (PIK3CB)
   04068 FoxO signaling pathway
    100584384 (PIK3CB)
   04070 Phosphatidylinositol signaling system
    100584384 (PIK3CB)
   04072 Phospholipase D signaling pathway
    100584384 (PIK3CB)
   04071 Sphingolipid signaling pathway
    100584384 (PIK3CB)
   04024 cAMP signaling pathway
    100584384 (PIK3CB)
   04151 PI3K-Akt signaling pathway
    100584384 (PIK3CB)
   04152 AMPK signaling pathway
    100584384 (PIK3CB)
   04150 mTOR signaling pathway
    100584384 (PIK3CB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100584384 (PIK3CB)
  09143 Cell growth and death
   04210 Apoptosis
    100584384 (PIK3CB)
   04218 Cellular senescence
    100584384 (PIK3CB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100584384 (PIK3CB)
   04550 Signaling pathways regulating pluripotency of stem cells
    100584384 (PIK3CB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100584384 (PIK3CB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100584384 (PIK3CB)
   04613 Neutrophil extracellular trap formation
    100584384 (PIK3CB)
   04620 Toll-like receptor signaling pathway
    100584384 (PIK3CB)
   04625 C-type lectin receptor signaling pathway
    100584384 (PIK3CB)
   04650 Natural killer cell mediated cytotoxicity
    100584384 (PIK3CB)
   04660 T cell receptor signaling pathway
    100584384 (PIK3CB)
   04662 B cell receptor signaling pathway
    100584384 (PIK3CB)
   04664 Fc epsilon RI signaling pathway
    100584384 (PIK3CB)
   04666 Fc gamma R-mediated phagocytosis
    100584384 (PIK3CB)
   04670 Leukocyte transendothelial migration
    100584384 (PIK3CB)
   04062 Chemokine signaling pathway
    100584384 (PIK3CB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100584384 (PIK3CB)
   04923 Regulation of lipolysis in adipocytes
    100584384 (PIK3CB)
   04929 GnRH secretion
    100584384 (PIK3CB)
   04915 Estrogen signaling pathway
    100584384 (PIK3CB)
   04914 Progesterone-mediated oocyte maturation
    100584384 (PIK3CB)
   04917 Prolactin signaling pathway
    100584384 (PIK3CB)
   04926 Relaxin signaling pathway
    100584384 (PIK3CB)
   04935 Growth hormone synthesis, secretion and action
    100584384 (PIK3CB)
   04919 Thyroid hormone signaling pathway
    100584384 (PIK3CB)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100584384 (PIK3CB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100584384 (PIK3CB)
  09156 Nervous system
   04725 Cholinergic synapse
    100584384 (PIK3CB)
   04722 Neurotrophin signaling pathway
    100584384 (PIK3CB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100584384 (PIK3CB)
  09158 Development and regeneration
   04360 Axon guidance
    100584384 (PIK3CB)
   04380 Osteoclast differentiation
    100584384 (PIK3CB)
  09149 Aging
   04211 Longevity regulating pathway
    100584384 (PIK3CB)
   04213 Longevity regulating pathway - multiple species
    100584384 (PIK3CB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100584384 (PIK3CB)
   05206 MicroRNAs in cancer
    100584384 (PIK3CB)
   05205 Proteoglycans in cancer
    100584384 (PIK3CB)
   05203 Viral carcinogenesis
    100584384 (PIK3CB)
   05230 Central carbon metabolism in cancer
    100584384 (PIK3CB)
   05231 Choline metabolism in cancer
    100584384 (PIK3CB)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100584384 (PIK3CB)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100584384 (PIK3CB)
   05212 Pancreatic cancer
    100584384 (PIK3CB)
   05225 Hepatocellular carcinoma
    100584384 (PIK3CB)
   05226 Gastric cancer
    100584384 (PIK3CB)
   05214 Glioma
    100584384 (PIK3CB)
   05221 Acute myeloid leukemia
    100584384 (PIK3CB)
   05220 Chronic myeloid leukemia
    100584384 (PIK3CB)
   05218 Melanoma
    100584384 (PIK3CB)
   05211 Renal cell carcinoma
    100584384 (PIK3CB)
   05215 Prostate cancer
    100584384 (PIK3CB)
   05213 Endometrial cancer
    100584384 (PIK3CB)
   05224 Breast cancer
    100584384 (PIK3CB)
   05222 Small cell lung cancer
    100584384 (PIK3CB)
   05223 Non-small cell lung cancer
    100584384 (PIK3CB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100584384 (PIK3CB)
   05017 Spinocerebellar ataxia
    100584384 (PIK3CB)
   05020 Prion disease
    100584384 (PIK3CB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100584384 (PIK3CB)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100584384 (PIK3CB)
   04932 Non-alcoholic fatty liver disease
    100584384 (PIK3CB)
   04931 Insulin resistance
    100584384 (PIK3CB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100584384 (PIK3CB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100584384 (PIK3CB)
   05135 Yersinia infection
    100584384 (PIK3CB)
   05100 Bacterial invasion of epithelial cells
    100584384 (PIK3CB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100584384 (PIK3CB)
   05170 Human immunodeficiency virus 1 infection
    100584384 (PIK3CB)
   05161 Hepatitis B
    100584384 (PIK3CB)
   05160 Hepatitis C
    100584384 (PIK3CB)
   05171 Coronavirus disease - COVID-19
    100584384 (PIK3CB)
   05164 Influenza A
    100584384 (PIK3CB)
   05162 Measles
    100584384 (PIK3CB)
   05168 Herpes simplex virus 1 infection
    100584384 (PIK3CB)
   05163 Human cytomegalovirus infection
    100584384 (PIK3CB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100584384 (PIK3CB)
   05169 Epstein-Barr virus infection
    100584384 (PIK3CB)
   05165 Human papillomavirus infection
    100584384 (PIK3CB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100584384 (PIK3CB)
   05142 Chagas disease
    100584384 (PIK3CB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100584384 (PIK3CB)
   01524 Platinum drug resistance
    100584384 (PIK3CB)
   01522 Endocrine resistance
    100584384 (PIK3CB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nle04131]
    100584384 (PIK3CB)
Enzymes [BR:nle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100584384 (PIK3CB)
Membrane trafficking [BR:nle04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100584384 (PIK3CB)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_p85B PI3K_C2 Tom37_C DUF4381
Other DBs
NCBI-GeneID: 100584384
NCBI-ProteinID: XP_030672609
Ensembl: ENSNLEG00000004334
LinkDB
Position
8
AA seq 1070 aa
MCFSFIMPPAMADILDIWAVDSQIASDGSIPVDFLLPTGIYIQLEVPREATISYIKQMLW
KQVHNYPMFNLLMDIDSYMFACVNQTAVYEELEDETRRLCDVRPFLPVLKLVTRSCDPGE
KLDSKIGVLIGKGLHEFDSLKDPEVNEFRRKMYKFSEEKILSLVGLSWMDWLKQTYPPEH
EPSIPENLEDKLYGGKLIVAVHFENCQDVFSFQVSPNMNPIKVNELAIQKRLTIHGKEDE
VSPCDYVLQVSGRVEYVFGDHPLIQFQYIRNCVMNRTLPHFILVECCKIKKMYEQEMIAI
EAAINRNSSNLPLPLPPKKTRIISHVWENNNPFQIVLVKGNKLNTEETVKVHVRAGLFHG
TELLCKTIVSSEVSGKNDHIWNEPLEFDINICDLPRMARLCFAVYAVLDKVKTKKSTKTI
NPSKYQTIRKAGKVHYPVAWVNTMVFDFKGQLRTGDIILHSWSSFPDELEEMLNPMGTVQ
TNPYTENATALHVKFPENKKQPYYYPPFDKIIEKAAEIASSDSANVSSRGGKKFLPVLKE
ILDRDPLSQLCENEMDLIWTLRQDCREIFPQSLPKLLLSIKWNKLEDVAQLQALLQIWPK
LPPREALELLDFNYPDQYVREYAVGCLRQMSDEELSQYLLQLVQVLKYEPFLDCALSRFL
LERALGNRRIGQFLFWHLRSEVHIPAVSVQFGVILEAYCRGSVGHMKVLSKQVEALNKLK
TLNSLIKLNAVKLNRAKGKEAMHTCLKQSAYREALSDLQSPLNPCVILSELYVEKCKYMD
SKMKPLWLVYNNKVFGEDSVGVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYG
CLATGDRSGLIEVVSTSETIADIQLNSSNVAAAAAFNKDALLNWLKEYNSGDDLDRAIEE
FTLSCAGYCVASYVLGIGDRHSDNIMVKKTGQLFHIDFGHILGNFKSKFGIKRERVPFIL
TYDFIHVIQQGKTGNTEKFGRFRQCCEDAYLILRRHGNLFITLFALMLTAGLPELTSVKD
IQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS
NT seq 3213 nt   +upstreamnt  +downstreamnt
atgtgcttcagtttcataatgcctcctgctatggcagacatccttgacatctgggcggtg
gattcacagatagcatctgatggctccatacctgtggatttccttttgcccactgggatt
tatatccagttggaggtacctcgggaagctaccatttcttatattaagcagatgttatgg
aagcaagttcacaattacccaatgttcaacctccttatggatattgactcctatatgttt
gcatgtgtgaaccagactgctgtatatgaggagcttgaagatgagacacgaagactctgt
gatgtcagaccttttcttccagttctcaaattagtgacaagaagttgtgacccaggggaa
aaattagactcaaaaattggagtccttataggaaaaggtctgcatgaatttgattccttg
aaggatcctgaagtaaatgaatttcgaagaaaaatgtacaaattcagcgaggaaaaaatc
ctgtcacttgtgggattgtcttggatggactggctaaaacaaacatatccaccagagcat
gaaccatccatccctgaaaacttggaagacaaactttatgggggaaagctcattgtagct
gttcattttgaaaactgccaggatgtgtttagctttcaagtgtctcctaatatgaatcct
atcaaagtaaatgaattggcaatccaaaaacgtttgactattcatgggaaggaagatgaa
gttagcccctgtgattatgtgttgcaagtcagcgggagagtagaatatgtttttggtgat
catccgctaattcagttccagtatatccggaactgtgtgatgaacaggaccctgccccat
tttatacttgtggaatgctgcaagatcaagaaaatgtatgaacaggaaatgattgccata
gaggctgccataaatcgaaattcatctaaccttccccttccattaccaccaaagaaaaca
cgaattatttctcatgtttgggaaaataacaaccctttccaaattgtcttggttaaggga
aataaacttaacacagaggaaactgtaaaagttcatgtcagggctggtctttttcatggt
actgagctcctgtgtaaaaccatcgtaagctcagaggtatcagggaaaaatgatcatatt
tggaatgaaccactggaatttgatattaatatttgtgacttaccacgaatggctcgatta
tgttttgctgtttatgcagttttggataaagtaaaaacgaagaaatcaacgaaaactatt
aatccctctaaatatcagaccatcaggaaagctggaaaagtgcattatcctgtagcgtgg
gtaaatacgatggtttttgactttaaaggacaattgagaactggagacataatattacac
agctggtcttcatttcctgatgaactcgaagagatgttgaatccaatgggaactgttcaa
acaaatccatatactgaaaatgcaaccgctttgcatgttaaatttccagagaataaaaaa
caaccttattattacccccccttcgataagattattgaaaaggcagctgagattgcaagc
agtgatagtgctaatgtgtcaagtcgaggtggaaaaaagtttcttcctgtattgaaagaa
atcttggacagggatcccttgtctcaactgtgtgaaaatgagatggatcttatttggact
ttacgacaagactgccgagagattttcccacaatcgctgccaaaattactgctgtcaatc
aagtggaataaacttgaggatgttgctcagcttcaggcgctgcttcagatttggcctaaa
ctgcccccccgggaggccctagagcttctggatttcaactatccagaccagtatgttcga
gaatatgctgtaggctgcctgcgacagatgagtgatgaagaactttctcagtatctttta
caactggtgcaagttttaaaatatgagccttttcttgattgtgccctctctagattccta
ttagaaagagcacttggtaatcggaggatagggcagtttctattttggcatcttaggtca
gaagtgcacattcctgctgtctcagtacaatttggtgtcatccttgaagcatactgccgg
ggaagtgtggggcacatgaaagtgctttctaagcaggttgaagcactcaataagttaaaa
actttaaatagtttaataaaactgaatgccgtgaagttaaacagagccaaagggaaggag
gccatgcacacctgtttaaaacagagtgcttaccgggaagccctgtctgacctgcagtca
ccgctgaacccatgtgttatcctctcggaactctatgttgaaaagtgcaaatacatggat
tccaaaatgaagcctttgtggctggtatacaataacaaggtatttggtgaggattcagtt
ggagtgatttttaaaaatggtgatgatttacgacaggatatgttgacactccaaatgttg
cgcttgatggatttactttggaaagaagctggtttggatcttcggatgttgccttatggc
tgtttagcaacaggagatcgctctggcctcattgaagttgtgagcacctctgaaacaatt
gctgacattcagctgaacagtagcaatgtggctgctgcagcagccttcaacaaagatgcc
cttctgaactggcttaaagaatacaattctggggatgacctggaccgagccattgaggaa
tttacactgtcctgtgctggctactgtgtagcttcttatgtccttgggattggtgacaga
catagtgacaacatcatggtcaaaaaaactggccagctcttccacattgactttggacat
attcttggaaatttcaaatctaagtttggcattaaaagggagcgagtgccttttattctt
acctatgatttcatccatgtcattcaacaaggaaaaacaggaaatacagaaaagtttggc
cggttccgccagtgttgtgaggatgcatatctgattttacgacggcatgggaatctcttc
attactctctttgcgctgatgttgactgcagggcttcctgaactcacatcagtcaaagat
atacagtatcttaaggactcccttgcattagggaagagtgaagaagaagcactcaaacag
tttaagcaaaaatttgatgaggcgctcagggaaagctggactactaaagttaactggatg
gcccacacagttcggaaagactacagatcttaa

KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100588218
Entry
100588218         CDS       T03265                                 

Gene name
PIK3CA
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle00562  Inositol phosphate metabolism
nle01100  Metabolic pathways
nle01521  EGFR tyrosine kinase inhibitor resistance
nle01522  Endocrine resistance
nle01524  Platinum drug resistance
nle04012  ErbB signaling pathway
nle04014  Ras signaling pathway
nle04015  Rap1 signaling pathway
nle04024  cAMP signaling pathway
nle04062  Chemokine signaling pathway
nle04066  HIF-1 signaling pathway
nle04068  FoxO signaling pathway
nle04070  Phosphatidylinositol signaling system
nle04071  Sphingolipid signaling pathway
nle04072  Phospholipase D signaling pathway
nle04140  Autophagy - animal
nle04150  mTOR signaling pathway
nle04151  PI3K-Akt signaling pathway
nle04152  AMPK signaling pathway
nle04210  Apoptosis
nle04211  Longevity regulating pathway
nle04213  Longevity regulating pathway - multiple species
nle04218  Cellular senescence
nle04360  Axon guidance
nle04370  VEGF signaling pathway
nle04380  Osteoclast differentiation
nle04510  Focal adhesion
nle04550  Signaling pathways regulating pluripotency of stem cells
nle04611  Platelet activation
nle04613  Neutrophil extracellular trap formation
nle04620  Toll-like receptor signaling pathway
nle04625  C-type lectin receptor signaling pathway
nle04630  JAK-STAT signaling pathway
nle04650  Natural killer cell mediated cytotoxicity
nle04660  T cell receptor signaling pathway
nle04662  B cell receptor signaling pathway
nle04664  Fc epsilon RI signaling pathway
nle04666  Fc gamma R-mediated phagocytosis
nle04668  TNF signaling pathway
nle04670  Leukocyte transendothelial migration
nle04722  Neurotrophin signaling pathway
nle04725  Cholinergic synapse
nle04750  Inflammatory mediator regulation of TRP channels
nle04810  Regulation of actin cytoskeleton
nle04910  Insulin signaling pathway
nle04914  Progesterone-mediated oocyte maturation
nle04915  Estrogen signaling pathway
nle04917  Prolactin signaling pathway
nle04919  Thyroid hormone signaling pathway
nle04923  Regulation of lipolysis in adipocytes
nle04926  Relaxin signaling pathway
nle04929  GnRH secretion
nle04930  Type II diabetes mellitus
nle04931  Insulin resistance
nle04932  Non-alcoholic fatty liver disease
nle04933  AGE-RAGE signaling pathway in diabetic complications
nle04935  Growth hormone synthesis, secretion and action
nle04960  Aldosterone-regulated sodium reabsorption
nle04973  Carbohydrate digestion and absorption
nle05010  Alzheimer disease
nle05017  Spinocerebellar ataxia
nle05020  Prion disease
nle05100  Bacterial invasion of epithelial cells
nle05132  Salmonella infection
nle05135  Yersinia infection
nle05142  Chagas disease
nle05146  Amoebiasis
nle05160  Hepatitis C
nle05161  Hepatitis B
nle05162  Measles
nle05163  Human cytomegalovirus infection
nle05164  Influenza A
nle05165  Human papillomavirus infection
nle05166  Human T-cell leukemia virus 1 infection
nle05167  Kaposi sarcoma-associated herpesvirus infection
nle05168  Herpes simplex virus 1 infection
nle05169  Epstein-Barr virus infection
nle05170  Human immunodeficiency virus 1 infection
nle05171  Coronavirus disease - COVID-19
nle05200  Pathways in cancer
nle05203  Viral carcinogenesis
nle05205  Proteoglycans in cancer
nle05206  MicroRNAs in cancer
nle05210  Colorectal cancer
nle05211  Renal cell carcinoma
nle05212  Pancreatic cancer
nle05213  Endometrial cancer
nle05214  Glioma
nle05215  Prostate cancer
nle05218  Melanoma
nle05220  Chronic myeloid leukemia
nle05221  Acute myeloid leukemia
nle05222  Small cell lung cancer
nle05223  Non-small cell lung cancer
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
nle05230  Central carbon metabolism in cancer
nle05231  Choline metabolism in cancer
nle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
nle05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:nle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100588218 (PIK3CA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100588218 (PIK3CA)
   04014 Ras signaling pathway
    100588218 (PIK3CA)
   04015 Rap1 signaling pathway
    100588218 (PIK3CA)
   04370 VEGF signaling pathway
    100588218 (PIK3CA)
   04630 JAK-STAT signaling pathway
    100588218 (PIK3CA)
   04668 TNF signaling pathway
    100588218 (PIK3CA)
   04066 HIF-1 signaling pathway
    100588218 (PIK3CA)
   04068 FoxO signaling pathway
    100588218 (PIK3CA)
   04070 Phosphatidylinositol signaling system
    100588218 (PIK3CA)
   04072 Phospholipase D signaling pathway
    100588218 (PIK3CA)
   04071 Sphingolipid signaling pathway
    100588218 (PIK3CA)
   04024 cAMP signaling pathway
    100588218 (PIK3CA)
   04151 PI3K-Akt signaling pathway
    100588218 (PIK3CA)
   04152 AMPK signaling pathway
    100588218 (PIK3CA)
   04150 mTOR signaling pathway
    100588218 (PIK3CA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100588218 (PIK3CA)
  09143 Cell growth and death
   04210 Apoptosis
    100588218 (PIK3CA)
   04218 Cellular senescence
    100588218 (PIK3CA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100588218 (PIK3CA)
   04550 Signaling pathways regulating pluripotency of stem cells
    100588218 (PIK3CA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100588218 (PIK3CA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100588218 (PIK3CA)
   04613 Neutrophil extracellular trap formation
    100588218 (PIK3CA)
   04620 Toll-like receptor signaling pathway
    100588218 (PIK3CA)
   04625 C-type lectin receptor signaling pathway
    100588218 (PIK3CA)
   04650 Natural killer cell mediated cytotoxicity
    100588218 (PIK3CA)
   04660 T cell receptor signaling pathway
    100588218 (PIK3CA)
   04662 B cell receptor signaling pathway
    100588218 (PIK3CA)
   04664 Fc epsilon RI signaling pathway
    100588218 (PIK3CA)
   04666 Fc gamma R-mediated phagocytosis
    100588218 (PIK3CA)
   04670 Leukocyte transendothelial migration
    100588218 (PIK3CA)
   04062 Chemokine signaling pathway
    100588218 (PIK3CA)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100588218 (PIK3CA)
   04923 Regulation of lipolysis in adipocytes
    100588218 (PIK3CA)
   04929 GnRH secretion
    100588218 (PIK3CA)
   04915 Estrogen signaling pathway
    100588218 (PIK3CA)
   04914 Progesterone-mediated oocyte maturation
    100588218 (PIK3CA)
   04917 Prolactin signaling pathway
    100588218 (PIK3CA)
   04926 Relaxin signaling pathway
    100588218 (PIK3CA)
   04935 Growth hormone synthesis, secretion and action
    100588218 (PIK3CA)
   04919 Thyroid hormone signaling pathway
    100588218 (PIK3CA)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100588218 (PIK3CA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100588218 (PIK3CA)
  09156 Nervous system
   04725 Cholinergic synapse
    100588218 (PIK3CA)
   04722 Neurotrophin signaling pathway
    100588218 (PIK3CA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100588218 (PIK3CA)
  09158 Development and regeneration
   04360 Axon guidance
    100588218 (PIK3CA)
   04380 Osteoclast differentiation
    100588218 (PIK3CA)
  09149 Aging
   04211 Longevity regulating pathway
    100588218 (PIK3CA)
   04213 Longevity regulating pathway - multiple species
    100588218 (PIK3CA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100588218 (PIK3CA)
   05206 MicroRNAs in cancer
    100588218 (PIK3CA)
   05205 Proteoglycans in cancer
    100588218 (PIK3CA)
   05203 Viral carcinogenesis
    100588218 (PIK3CA)
   05230 Central carbon metabolism in cancer
    100588218 (PIK3CA)
   05231 Choline metabolism in cancer
    100588218 (PIK3CA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100588218 (PIK3CA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100588218 (PIK3CA)
   05212 Pancreatic cancer
    100588218 (PIK3CA)
   05225 Hepatocellular carcinoma
    100588218 (PIK3CA)
   05226 Gastric cancer
    100588218 (PIK3CA)
   05214 Glioma
    100588218 (PIK3CA)
   05221 Acute myeloid leukemia
    100588218 (PIK3CA)
   05220 Chronic myeloid leukemia
    100588218 (PIK3CA)
   05218 Melanoma
    100588218 (PIK3CA)
   05211 Renal cell carcinoma
    100588218 (PIK3CA)
   05215 Prostate cancer
    100588218 (PIK3CA)
   05213 Endometrial cancer
    100588218 (PIK3CA)
   05224 Breast cancer
    100588218 (PIK3CA)
   05222 Small cell lung cancer
    100588218 (PIK3CA)
   05223 Non-small cell lung cancer
    100588218 (PIK3CA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100588218 (PIK3CA)
   05017 Spinocerebellar ataxia
    100588218 (PIK3CA)
   05020 Prion disease
    100588218 (PIK3CA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100588218 (PIK3CA)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100588218 (PIK3CA)
   04932 Non-alcoholic fatty liver disease
    100588218 (PIK3CA)
   04931 Insulin resistance
    100588218 (PIK3CA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100588218 (PIK3CA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100588218 (PIK3CA)
   05135 Yersinia infection
    100588218 (PIK3CA)
   05100 Bacterial invasion of epithelial cells
    100588218 (PIK3CA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100588218 (PIK3CA)
   05170 Human immunodeficiency virus 1 infection
    100588218 (PIK3CA)
   05161 Hepatitis B
    100588218 (PIK3CA)
   05160 Hepatitis C
    100588218 (PIK3CA)
   05171 Coronavirus disease - COVID-19
    100588218 (PIK3CA)
   05164 Influenza A
    100588218 (PIK3CA)
   05162 Measles
    100588218 (PIK3CA)
   05168 Herpes simplex virus 1 infection
    100588218 (PIK3CA)
   05163 Human cytomegalovirus infection
    100588218 (PIK3CA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100588218 (PIK3CA)
   05169 Epstein-Barr virus infection
    100588218 (PIK3CA)
   05165 Human papillomavirus infection
    100588218 (PIK3CA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100588218 (PIK3CA)
   05142 Chagas disease
    100588218 (PIK3CA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100588218 (PIK3CA)
   01524 Platinum drug resistance
    100588218 (PIK3CA)
   01522 Endocrine resistance
    100588218 (PIK3CA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nle04131]
    100588218 (PIK3CA)
Enzymes [BR:nle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100588218 (PIK3CA)
Membrane trafficking [BR:nle04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100588218 (PIK3CA)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 ASC Ribosomal_S15
Other DBs
NCBI-GeneID: 100588218
NCBI-ProteinID: XP_030678706
Ensembl: ENSNLEG00000005661
LinkDB
Position
11
AA seq 1068 aa
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLITIKHELFKEARKYPLHQ
LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPMD
CFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SSVVKFPDMSVIEEHANWSVSREAGFSYSHAGLSNRLARDNELRENDKEQLKAISTRDPL
SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAME
LLDCNYPDPMVRGFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRRPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgcctccacgaccatcatcaggtgaactgtggggcatccacttgatgcccccaagaatc
ctagtagaatgtttactaccaaatggaatgatagtgactttagaatgcctccgtgaggct
acattaataaccataaagcatgaactatttaaagaagcaagaaaataccccctccatcaa
cttcttcaagatgaatcttcttacattttcgtaagtgttactcaagaagcagaaagggaa
gaattttttgatgaaacaagacgactttgtgaccttcggctttttcaaccctttttaaaa
gtaattgaaccagtaggcaaccgtgaagaaaagatcctcaatcgagaaattggttttgct
atcggcatgccagtgtgtgaatttgatatggttaaagatccagaagtacaggacttccga
agaaatattctgaatgtttgtaaagaagctgtggatcttcgggacctcaattcacctcat
agtagagcaatgtatgtctatcctccaaatgtagaatcttcaccagaattgccaaagcac
atatataataaattagataaagggcaaataatagtggtgatctgggtaatagtttctcca
aataatgacaagcagaagtatactctgaaaatcaaccatgactgtgtaccagaacaagtc
attgctgaagcaatcaggaaaaaaactcgaagtatgttgctatcctctgaacaactaaaa
ctctgtgttttagagtatcagggcaagtatattttaaaagtgtgtggatgtgatgaatac
ttcctagaaaaatatcctctgagtcagtataagtatataagaagctgtataatgcttggg
aggatgcccaatttgatgttgatggccaaagaaagcctttattctcaactgccaatggac
tgttttacaatgccatcttattccagacgcatttccacagctacaccatatatgaatgga
gaaacatctacaaaatccctttgggttataaatagtgcactcagaataaaaattctttgt
gcaacctacgtgaatgtaaatattcgagacattgataagatctatgttcgaacaggtatc
taccatggaggagaacccttatgtgacaatgtgaacactcaaagagtaccttgttccaat
cccaggtggaatgaatggctgaattatgatatatacattcctgatcttcctcgtgctgct
cgactttgcctttccatttgttctgttaaaggccgaaagggtgctaaagaggaacactgt
ccattggcatggggaaatataaacttgtttgattacacagacactctagtatctggaaaa
atggctttgaatctttggccagtacctcatggattagaagatttgctgaaccctattggt
gttactggatcaaatccaaataaagaaactccatgcttagagttggagtttgactggttc
agcagtgtggtaaagttcccagatatgtcagtgattgaagagcatgccaattggtctgta
tcccgagaagcaggatttagctattcccacgcaggactgagtaacagactagctagagac
aatgaattaagggaaaatgacaaagaacagctcaaagcaatttctacacgagatcctctc
tctgaaatcactgagcaggagaaagattttctatggagccacagacactattgtgtaact
atccccgaaattctacccaaattgcttctgtctgttaaatggaattctagagatgaagta
gcccagatgtattgcttggtaaaagattggcctccaatcaaacctgaacaggctatggaa
cttctggactgtaattacccagatcctatggttcgaggttttgctgttcggtgcttggaa
aaatacttaacagatgacaaactttctcagtatttaattcagctagtacaggtcctaaaa
tatgaacaatatttggataacttgcttgtgagatttttactgaagaaagcattgactaat
caaaggattgggcactttttcttttggcatttaaaatctgagatgcacaataaaacagtt
agccagaggtttggcctgcttttggagtcctattgtcgtgcatgtgggatgtatttgaag
cacctgaataggcaagtcgaggcaatggagaagctcattaacttaactgacattctcaaa
caggagaagaaggatgaaacacaaaaggtacagatgaagtttttagttgagcaaatgaga
cgaccagatttcatggatgctctacagggctttctgtctcctctaaaccctgctcatcaa
ctaggaaatctcaggcttgaagagtgtcgaattatgtcctctgcaaaaaggccactgtgg
ttgaattgggagaacccagacatcatgtcagagttactgtttcagaacaatgagatcatc
tttaaaaatggggatgatttacggcaagatatgctaacacttcaaattattcgtattatg
gaaaatatctggcaaaatcaaggtcttgatcttcgaatgttaccttatggttgtctttca
atcggtgactgtgtgggacttattgaggtggtgcgaaattctcacactattatgcaaatt
cagtgcaaaggcggcttgaaaggtgcactgcagttcaacagccacacactacatcagtgg
cttaaagacaagaacaaaggagaaatatatgatgcagccattgacctgtttacacgttca
tgtgctggatattgtgtagctaccttcattttgggaattggagatcgtcacaatagtaac
atcatggtgaaagacgatggacaactgtttcatatagattttggacactttttggatcac
aagaagaaaaaatttggttataaacgagaacgtgtgccatttgttttgacacaggatttc
ttaatagtgattagtaaaggagcccaagaatgcacaaagacaagagaatttgagaggttt
caggagatgtgttacaaggcttatctagctattcgacagcatgccaatctcttcataaat
cttttctcaatgatgcttggctctggaatgccagaactacaatcttttgatgacattgca
tacattcgaaagaccctagccttagataaaactgagcaagaggctttggagtatttcatg
aaacaaatgaatgatgcacatcatggtggctggacaacaaaaatggattggatcttccac
acaattaaacagcatgcattgaactga

KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100591270
Entry
100591270         CDS       T03265                                 

Gene name
PIK3R3
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma isoform X1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle01521  EGFR tyrosine kinase inhibitor resistance
nle01522  Endocrine resistance
nle01524  Platinum drug resistance
nle04012  ErbB signaling pathway
nle04014  Ras signaling pathway
nle04015  Rap1 signaling pathway
nle04024  cAMP signaling pathway
nle04062  Chemokine signaling pathway
nle04066  HIF-1 signaling pathway
nle04068  FoxO signaling pathway
nle04070  Phosphatidylinositol signaling system
nle04071  Sphingolipid signaling pathway
nle04072  Phospholipase D signaling pathway
nle04140  Autophagy - animal
nle04150  mTOR signaling pathway
nle04151  PI3K-Akt signaling pathway
nle04152  AMPK signaling pathway
nle04210  Apoptosis
nle04211  Longevity regulating pathway
nle04213  Longevity regulating pathway - multiple species
nle04218  Cellular senescence
nle04360  Axon guidance
nle04370  VEGF signaling pathway
nle04380  Osteoclast differentiation
nle04510  Focal adhesion
nle04550  Signaling pathways regulating pluripotency of stem cells
nle04611  Platelet activation
nle04613  Neutrophil extracellular trap formation
nle04620  Toll-like receptor signaling pathway
nle04625  C-type lectin receptor signaling pathway
nle04630  JAK-STAT signaling pathway
nle04650  Natural killer cell mediated cytotoxicity
nle04660  T cell receptor signaling pathway
nle04662  B cell receptor signaling pathway
nle04664  Fc epsilon RI signaling pathway
nle04666  Fc gamma R-mediated phagocytosis
nle04668  TNF signaling pathway
nle04670  Leukocyte transendothelial migration
nle04722  Neurotrophin signaling pathway
nle04725  Cholinergic synapse
nle04750  Inflammatory mediator regulation of TRP channels
nle04810  Regulation of actin cytoskeleton
nle04910  Insulin signaling pathway
nle04914  Progesterone-mediated oocyte maturation
nle04915  Estrogen signaling pathway
nle04917  Prolactin signaling pathway
nle04919  Thyroid hormone signaling pathway
nle04923  Regulation of lipolysis in adipocytes
nle04926  Relaxin signaling pathway
nle04929  GnRH secretion
nle04930  Type II diabetes mellitus
nle04931  Insulin resistance
nle04932  Non-alcoholic fatty liver disease
nle04933  AGE-RAGE signaling pathway in diabetic complications
nle04935  Growth hormone synthesis, secretion and action
nle04960  Aldosterone-regulated sodium reabsorption
nle04973  Carbohydrate digestion and absorption
nle05010  Alzheimer disease
nle05017  Spinocerebellar ataxia
nle05020  Prion disease
nle05100  Bacterial invasion of epithelial cells
nle05135  Yersinia infection
nle05142  Chagas disease
nle05146  Amoebiasis
nle05160  Hepatitis C
nle05161  Hepatitis B
nle05162  Measles
nle05163  Human cytomegalovirus infection
nle05164  Influenza A
nle05165  Human papillomavirus infection
nle05166  Human T-cell leukemia virus 1 infection
nle05167  Kaposi sarcoma-associated herpesvirus infection
nle05168  Herpes simplex virus 1 infection
nle05169  Epstein-Barr virus infection
nle05170  Human immunodeficiency virus 1 infection
nle05171  Coronavirus disease - COVID-19
nle05200  Pathways in cancer
nle05203  Viral carcinogenesis
nle05205  Proteoglycans in cancer
nle05206  MicroRNAs in cancer
nle05210  Colorectal cancer
nle05211  Renal cell carcinoma
nle05212  Pancreatic cancer
nle05213  Endometrial cancer
nle05214  Glioma
nle05215  Prostate cancer
nle05218  Melanoma
nle05220  Chronic myeloid leukemia
nle05221  Acute myeloid leukemia
nle05222  Small cell lung cancer
nle05223  Non-small cell lung cancer
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
nle05230  Central carbon metabolism in cancer
nle05231  Choline metabolism in cancer
nle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
nle05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100591270 (PIK3R3)
   04014 Ras signaling pathway
    100591270 (PIK3R3)
   04015 Rap1 signaling pathway
    100591270 (PIK3R3)
   04370 VEGF signaling pathway
    100591270 (PIK3R3)
   04630 JAK-STAT signaling pathway
    100591270 (PIK3R3)
   04668 TNF signaling pathway
    100591270 (PIK3R3)
   04066 HIF-1 signaling pathway
    100591270 (PIK3R3)
   04068 FoxO signaling pathway
    100591270 (PIK3R3)
   04070 Phosphatidylinositol signaling system
    100591270 (PIK3R3)
   04072 Phospholipase D signaling pathway
    100591270 (PIK3R3)
   04071 Sphingolipid signaling pathway
    100591270 (PIK3R3)
   04024 cAMP signaling pathway
    100591270 (PIK3R3)
   04151 PI3K-Akt signaling pathway
    100591270 (PIK3R3)
   04152 AMPK signaling pathway
    100591270 (PIK3R3)
   04150 mTOR signaling pathway
    100591270 (PIK3R3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100591270 (PIK3R3)
  09143 Cell growth and death
   04210 Apoptosis
    100591270 (PIK3R3)
   04218 Cellular senescence
    100591270 (PIK3R3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100591270 (PIK3R3)
   04550 Signaling pathways regulating pluripotency of stem cells
    100591270 (PIK3R3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100591270 (PIK3R3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100591270 (PIK3R3)
   04613 Neutrophil extracellular trap formation
    100591270 (PIK3R3)
   04620 Toll-like receptor signaling pathway
    100591270 (PIK3R3)
   04625 C-type lectin receptor signaling pathway
    100591270 (PIK3R3)
   04650 Natural killer cell mediated cytotoxicity
    100591270 (PIK3R3)
   04660 T cell receptor signaling pathway
    100591270 (PIK3R3)
   04662 B cell receptor signaling pathway
    100591270 (PIK3R3)
   04664 Fc epsilon RI signaling pathway
    100591270 (PIK3R3)
   04666 Fc gamma R-mediated phagocytosis
    100591270 (PIK3R3)
   04670 Leukocyte transendothelial migration
    100591270 (PIK3R3)
   04062 Chemokine signaling pathway
    100591270 (PIK3R3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100591270 (PIK3R3)
   04923 Regulation of lipolysis in adipocytes
    100591270 (PIK3R3)
   04929 GnRH secretion
    100591270 (PIK3R3)
   04915 Estrogen signaling pathway
    100591270 (PIK3R3)
   04914 Progesterone-mediated oocyte maturation
    100591270 (PIK3R3)
   04917 Prolactin signaling pathway
    100591270 (PIK3R3)
   04926 Relaxin signaling pathway
    100591270 (PIK3R3)
   04935 Growth hormone synthesis, secretion and action
    100591270 (PIK3R3)
   04919 Thyroid hormone signaling pathway
    100591270 (PIK3R3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100591270 (PIK3R3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100591270 (PIK3R3)
  09156 Nervous system
   04725 Cholinergic synapse
    100591270 (PIK3R3)
   04722 Neurotrophin signaling pathway
    100591270 (PIK3R3)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100591270 (PIK3R3)
  09158 Development and regeneration
   04360 Axon guidance
    100591270 (PIK3R3)
   04380 Osteoclast differentiation
    100591270 (PIK3R3)
  09149 Aging
   04211 Longevity regulating pathway
    100591270 (PIK3R3)
   04213 Longevity regulating pathway - multiple species
    100591270 (PIK3R3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100591270 (PIK3R3)
   05206 MicroRNAs in cancer
    100591270 (PIK3R3)
   05205 Proteoglycans in cancer
    100591270 (PIK3R3)
   05203 Viral carcinogenesis
    100591270 (PIK3R3)
   05230 Central carbon metabolism in cancer
    100591270 (PIK3R3)
   05231 Choline metabolism in cancer
    100591270 (PIK3R3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100591270 (PIK3R3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100591270 (PIK3R3)
   05212 Pancreatic cancer
    100591270 (PIK3R3)
   05225 Hepatocellular carcinoma
    100591270 (PIK3R3)
   05226 Gastric cancer
    100591270 (PIK3R3)
   05214 Glioma
    100591270 (PIK3R3)
   05221 Acute myeloid leukemia
    100591270 (PIK3R3)
   05220 Chronic myeloid leukemia
    100591270 (PIK3R3)
   05218 Melanoma
    100591270 (PIK3R3)
   05211 Renal cell carcinoma
    100591270 (PIK3R3)
   05215 Prostate cancer
    100591270 (PIK3R3)
   05213 Endometrial cancer
    100591270 (PIK3R3)
   05224 Breast cancer
    100591270 (PIK3R3)
   05222 Small cell lung cancer
    100591270 (PIK3R3)
   05223 Non-small cell lung cancer
    100591270 (PIK3R3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100591270 (PIK3R3)
   05017 Spinocerebellar ataxia
    100591270 (PIK3R3)
   05020 Prion disease
    100591270 (PIK3R3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100591270 (PIK3R3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100591270 (PIK3R3)
   04932 Non-alcoholic fatty liver disease
    100591270 (PIK3R3)
   04931 Insulin resistance
    100591270 (PIK3R3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100591270 (PIK3R3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100591270 (PIK3R3)
   05100 Bacterial invasion of epithelial cells
    100591270 (PIK3R3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100591270 (PIK3R3)
   05170 Human immunodeficiency virus 1 infection
    100591270 (PIK3R3)
   05161 Hepatitis B
    100591270 (PIK3R3)
   05160 Hepatitis C
    100591270 (PIK3R3)
   05171 Coronavirus disease - COVID-19
    100591270 (PIK3R3)
   05164 Influenza A
    100591270 (PIK3R3)
   05162 Measles
    100591270 (PIK3R3)
   05168 Herpes simplex virus 1 infection
    100591270 (PIK3R3)
   05163 Human cytomegalovirus infection
    100591270 (PIK3R3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100591270 (PIK3R3)
   05169 Epstein-Barr virus infection
    100591270 (PIK3R3)
   05165 Human papillomavirus infection
    100591270 (PIK3R3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100591270 (PIK3R3)
   05142 Chagas disease
    100591270 (PIK3R3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100591270 (PIK3R3)
   01524 Platinum drug resistance
    100591270 (PIK3R3)
   01522 Endocrine resistance
    100591270 (PIK3R3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nle04131]
    100591270 (PIK3R3)
Membrane trafficking [BR:nle04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100591270 (PIK3R3)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 Transcrip_act Cupin_8 Fez1 DUF5638
Other DBs
NCBI-GeneID: 100591270
NCBI-ProteinID: XP_003259085
Ensembl: ENSNLEG00000016649
UniProt: G1S3Y6
LinkDB
Position
12
AA seq 461 aa
MYNTVWSMDRDDADWREVMMPYSTELIFYIEMDPPALPPKPPKPMTSAVPNGMKDSSVSL
QDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDG
KYGFSDPLTFNSVVELITHYHHESLAQYNPKLDVKLMYPVSRYQQDQLVKEDNIDAVGKK
LQEYHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKEY
IERFRREGNEKEIERIMMNYDKLKSRLGEIHDSKMRLEQDLKKQALDNREIDKKMNSIKP
DLIQLRKIRDQHLVWLNHKGVRQKRLNVWLGIKNEDADENYFINEEDENLPHYDEKTWFV
EDINRVQAEDLLYGKPDGAFLIRESSKKGCYACSVVADGEVKHCVIYSTARGYGFAEPYN
LYSSLKELVLHYQQTSLVQHNDSLNVRLAYPVHAQMPSLCR
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgtacaatacggtgtggagtatggaccgcgatgacgcagactggagggaggtgatgatg
ccctattcgacagaactgatattttatattgaaatggatcctccagctcttccaccaaag
ccgcctaagccaatgacttcagcagttccaaatggaatgaaggacagttctgtttctctt
caggatgcagaatggtactggggggatatttcaagggaggaggtaaatgacaaattgcgg
gatatgccagatgggaccttcttggtccgagatgcctcaacaaaaatgcagggagattat
actttgactttgcggaagggaggcaataataagctaataaagatctatcaccgggatggt
aaatatggcttttctgatcctctgacatttaattccgtggtggagctcattacccactat
caccatgaatctcttgctcagtacaatcccaaacttgatgtgaagctgatgtacccagtg
tccagataccaacaggatcagttggtaaaagaagataatattgatgcagtaggtaaaaaa
ctgcaagaataccactctcagtatcaggagaagagtaaagagtatgataggctgtatgaa
gaatatactagaacatcccaggaaatacagatgaagaggactgcaatagaagcttttaat
gaaacaattaaaatatttgaagagcagtgtcacacacaagaacaacatagcaaagaatat
attgagcgatttcgcagagaggggaatgaaaaggagattgaacgaattatgatgaattat
gataaattgaaatcacgtctgggcgagattcatgatagcaaaatgcgtctagagcaggat
ttgaagaaacaagctttggacaaccgagaaatagataaaaaaatgaatagtatcaaacct
gacctgatccagctgcgaaagatccgagatcaacaccttgtatggctcaatcacaaagga
gtgagacagaaacgcctgaatgtctggctgggaattaagaatgaggatgctgatgagaac
tattttatcaatgaggaagatgaaaacctgccccattatgatgagaaaacctggtttgtt
gaggatatcaatcgagtacaagcagaagacttgctttatgggaaacctgatggtgcattc
ttaattcgtgagagtagcaaaaaaggatgctatgcttgctctgtggtggccgatggggaa
gtgaagcactgtgtgatctacagtactgctcggggctatggctttgcagagccctacaac
ctgtacagctctctgaaggagctagtgctccattaccagcagacatccttggttcagcac
aacgactccctcaacgtcaggcttgcctaccctgttcatgcacagatgccctcgctttgc
agataa

KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100599301
Entry
100599301         CDS       T03265                                 

Gene name
PIK3R2
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit beta
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle01521  EGFR tyrosine kinase inhibitor resistance
nle01522  Endocrine resistance
nle01524  Platinum drug resistance
nle04012  ErbB signaling pathway
nle04014  Ras signaling pathway
nle04015  Rap1 signaling pathway
nle04024  cAMP signaling pathway
nle04062  Chemokine signaling pathway
nle04066  HIF-1 signaling pathway
nle04068  FoxO signaling pathway
nle04070  Phosphatidylinositol signaling system
nle04071  Sphingolipid signaling pathway
nle04072  Phospholipase D signaling pathway
nle04140  Autophagy - animal
nle04150  mTOR signaling pathway
nle04151  PI3K-Akt signaling pathway
nle04152  AMPK signaling pathway
nle04210  Apoptosis
nle04211  Longevity regulating pathway
nle04213  Longevity regulating pathway - multiple species
nle04218  Cellular senescence
nle04360  Axon guidance
nle04370  VEGF signaling pathway
nle04380  Osteoclast differentiation
nle04510  Focal adhesion
nle04550  Signaling pathways regulating pluripotency of stem cells
nle04611  Platelet activation
nle04613  Neutrophil extracellular trap formation
nle04620  Toll-like receptor signaling pathway
nle04625  C-type lectin receptor signaling pathway
nle04630  JAK-STAT signaling pathway
nle04650  Natural killer cell mediated cytotoxicity
nle04660  T cell receptor signaling pathway
nle04662  B cell receptor signaling pathway
nle04664  Fc epsilon RI signaling pathway
nle04666  Fc gamma R-mediated phagocytosis
nle04668  TNF signaling pathway
nle04670  Leukocyte transendothelial migration
nle04722  Neurotrophin signaling pathway
nle04725  Cholinergic synapse
nle04750  Inflammatory mediator regulation of TRP channels
nle04810  Regulation of actin cytoskeleton
nle04910  Insulin signaling pathway
nle04914  Progesterone-mediated oocyte maturation
nle04915  Estrogen signaling pathway
nle04917  Prolactin signaling pathway
nle04919  Thyroid hormone signaling pathway
nle04923  Regulation of lipolysis in adipocytes
nle04926  Relaxin signaling pathway
nle04929  GnRH secretion
nle04930  Type II diabetes mellitus
nle04931  Insulin resistance
nle04932  Non-alcoholic fatty liver disease
nle04933  AGE-RAGE signaling pathway in diabetic complications
nle04935  Growth hormone synthesis, secretion and action
nle04960  Aldosterone-regulated sodium reabsorption
nle04973  Carbohydrate digestion and absorption
nle05010  Alzheimer disease
nle05017  Spinocerebellar ataxia
nle05020  Prion disease
nle05100  Bacterial invasion of epithelial cells
nle05135  Yersinia infection
nle05142  Chagas disease
nle05146  Amoebiasis
nle05160  Hepatitis C
nle05161  Hepatitis B
nle05162  Measles
nle05163  Human cytomegalovirus infection
nle05164  Influenza A
nle05165  Human papillomavirus infection
nle05166  Human T-cell leukemia virus 1 infection
nle05167  Kaposi sarcoma-associated herpesvirus infection
nle05168  Herpes simplex virus 1 infection
nle05169  Epstein-Barr virus infection
nle05170  Human immunodeficiency virus 1 infection
nle05171  Coronavirus disease - COVID-19
nle05200  Pathways in cancer
nle05203  Viral carcinogenesis
nle05205  Proteoglycans in cancer
nle05206  MicroRNAs in cancer
nle05210  Colorectal cancer
nle05211  Renal cell carcinoma
nle05212  Pancreatic cancer
nle05213  Endometrial cancer
nle05214  Glioma
nle05215  Prostate cancer
nle05218  Melanoma
nle05220  Chronic myeloid leukemia
nle05221  Acute myeloid leukemia
nle05222  Small cell lung cancer
nle05223  Non-small cell lung cancer
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
nle05230  Central carbon metabolism in cancer
nle05231  Choline metabolism in cancer
nle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
nle05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100599301 (PIK3R2)
   04014 Ras signaling pathway
    100599301 (PIK3R2)
   04015 Rap1 signaling pathway
    100599301 (PIK3R2)
   04370 VEGF signaling pathway
    100599301 (PIK3R2)
   04630 JAK-STAT signaling pathway
    100599301 (PIK3R2)
   04668 TNF signaling pathway
    100599301 (PIK3R2)
   04066 HIF-1 signaling pathway
    100599301 (PIK3R2)
   04068 FoxO signaling pathway
    100599301 (PIK3R2)
   04070 Phosphatidylinositol signaling system
    100599301 (PIK3R2)
   04072 Phospholipase D signaling pathway
    100599301 (PIK3R2)
   04071 Sphingolipid signaling pathway
    100599301 (PIK3R2)
   04024 cAMP signaling pathway
    100599301 (PIK3R2)
   04151 PI3K-Akt signaling pathway
    100599301 (PIK3R2)
   04152 AMPK signaling pathway
    100599301 (PIK3R2)
   04150 mTOR signaling pathway
    100599301 (PIK3R2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100599301 (PIK3R2)
  09143 Cell growth and death
   04210 Apoptosis
    100599301 (PIK3R2)
   04218 Cellular senescence
    100599301 (PIK3R2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100599301 (PIK3R2)
   04550 Signaling pathways regulating pluripotency of stem cells
    100599301 (PIK3R2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100599301 (PIK3R2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100599301 (PIK3R2)
   04613 Neutrophil extracellular trap formation
    100599301 (PIK3R2)
   04620 Toll-like receptor signaling pathway
    100599301 (PIK3R2)
   04625 C-type lectin receptor signaling pathway
    100599301 (PIK3R2)
   04650 Natural killer cell mediated cytotoxicity
    100599301 (PIK3R2)
   04660 T cell receptor signaling pathway
    100599301 (PIK3R2)
   04662 B cell receptor signaling pathway
    100599301 (PIK3R2)
   04664 Fc epsilon RI signaling pathway
    100599301 (PIK3R2)
   04666 Fc gamma R-mediated phagocytosis
    100599301 (PIK3R2)
   04670 Leukocyte transendothelial migration
    100599301 (PIK3R2)
   04062 Chemokine signaling pathway
    100599301 (PIK3R2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100599301 (PIK3R2)
   04923 Regulation of lipolysis in adipocytes
    100599301 (PIK3R2)
   04929 GnRH secretion
    100599301 (PIK3R2)
   04915 Estrogen signaling pathway
    100599301 (PIK3R2)
   04914 Progesterone-mediated oocyte maturation
    100599301 (PIK3R2)
   04917 Prolactin signaling pathway
    100599301 (PIK3R2)
   04926 Relaxin signaling pathway
    100599301 (PIK3R2)
   04935 Growth hormone synthesis, secretion and action
    100599301 (PIK3R2)
   04919 Thyroid hormone signaling pathway
    100599301 (PIK3R2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100599301 (PIK3R2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100599301 (PIK3R2)
  09156 Nervous system
   04725 Cholinergic synapse
    100599301 (PIK3R2)
   04722 Neurotrophin signaling pathway
    100599301 (PIK3R2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100599301 (PIK3R2)
  09158 Development and regeneration
   04360 Axon guidance
    100599301 (PIK3R2)
   04380 Osteoclast differentiation
    100599301 (PIK3R2)
  09149 Aging
   04211 Longevity regulating pathway
    100599301 (PIK3R2)
   04213 Longevity regulating pathway - multiple species
    100599301 (PIK3R2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100599301 (PIK3R2)
   05206 MicroRNAs in cancer
    100599301 (PIK3R2)
   05205 Proteoglycans in cancer
    100599301 (PIK3R2)
   05203 Viral carcinogenesis
    100599301 (PIK3R2)
   05230 Central carbon metabolism in cancer
    100599301 (PIK3R2)
   05231 Choline metabolism in cancer
    100599301 (PIK3R2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100599301 (PIK3R2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100599301 (PIK3R2)
   05212 Pancreatic cancer
    100599301 (PIK3R2)
   05225 Hepatocellular carcinoma
    100599301 (PIK3R2)
   05226 Gastric cancer
    100599301 (PIK3R2)
   05214 Glioma
    100599301 (PIK3R2)
   05221 Acute myeloid leukemia
    100599301 (PIK3R2)
   05220 Chronic myeloid leukemia
    100599301 (PIK3R2)
   05218 Melanoma
    100599301 (PIK3R2)
   05211 Renal cell carcinoma
    100599301 (PIK3R2)
   05215 Prostate cancer
    100599301 (PIK3R2)
   05213 Endometrial cancer
    100599301 (PIK3R2)
   05224 Breast cancer
    100599301 (PIK3R2)
   05222 Small cell lung cancer
    100599301 (PIK3R2)
   05223 Non-small cell lung cancer
    100599301 (PIK3R2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100599301 (PIK3R2)
   05017 Spinocerebellar ataxia
    100599301 (PIK3R2)
   05020 Prion disease
    100599301 (PIK3R2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100599301 (PIK3R2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100599301 (PIK3R2)
   04932 Non-alcoholic fatty liver disease
    100599301 (PIK3R2)
   04931 Insulin resistance
    100599301 (PIK3R2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100599301 (PIK3R2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100599301 (PIK3R2)
   05100 Bacterial invasion of epithelial cells
    100599301 (PIK3R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100599301 (PIK3R2)
   05170 Human immunodeficiency virus 1 infection
    100599301 (PIK3R2)
   05161 Hepatitis B
    100599301 (PIK3R2)
   05160 Hepatitis C
    100599301 (PIK3R2)
   05171 Coronavirus disease - COVID-19
    100599301 (PIK3R2)
   05164 Influenza A
    100599301 (PIK3R2)
   05162 Measles
    100599301 (PIK3R2)
   05168 Herpes simplex virus 1 infection
    100599301 (PIK3R2)
   05163 Human cytomegalovirus infection
    100599301 (PIK3R2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100599301 (PIK3R2)
   05169 Epstein-Barr virus infection
    100599301 (PIK3R2)
   05165 Human papillomavirus infection
    100599301 (PIK3R2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100599301 (PIK3R2)
   05142 Chagas disease
    100599301 (PIK3R2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100599301 (PIK3R2)
   01524 Platinum drug resistance
    100599301 (PIK3R2)
   01522 Endocrine resistance
    100599301 (PIK3R2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nle04131]
    100599301 (PIK3R2)
Membrane trafficking [BR:nle04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100599301 (PIK3R2)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_9 Ribosomal_L22e Tai4 ATG11
Other DBs
NCBI-GeneID: 100599301
NCBI-ProteinID: XP_003275871
Ensembl: ENSNLEG00000005931
UniProt: G1R1V3
LinkDB
Position
10
AA seq 727 aa
MAGPEGFQYRALYPFRRERPEDLELLPGDVLVVSRAALQALGVAEGGERCPQSVGWMPGL
NERTRQRGDFPGTYVEFLGPVALARPGPRPRGPRPLPARPRDGAPEPGLTLPDLPEQFSP
PDVAPPLLVKLVEAIERTGLDSESHYRPELPAPRTDWSLSDVDQWDAAALADGIKSFLLA
LPAPLVTPEALAEARRALREAAGPVGPALEPPTLPLHRALTLRFLLQHLGRVARRAPALG
PAVRALGATFGPLLLRAPPPSSPPPGGAPDGSEPSPDFPALLLEKLLQEHLEEQEVAPPA
LPPKPPKAKPAPTGLANGGSPPSLQDAEWYWGDISREEVNEKLRDTPDGTFLVRDASSKI
QGEYTLTLRKGGNNKLIKVFHRDGHYGFSEPLTFCSVVDLINHYRHESLAQYNAKLDTRL
LYPVSKYQQDQIVKEDSVEAVGAQLKVYHQQYQDKSREYDQLYEEYTRTSQELQMKRTAI
EAFNETIKIFEEQGQTQEKCSKEYLERFRREGNEKEMQRILLNSERLKSRIAEIHESRTK
LEQQLRAQASDNREIDKRMNSLKPDLMQLRKIRDQYLVWLTQKGARQKKINEWLGIKNET
EDQYALMEDEDDLPHHEERTWYVGKINRTQAEEMLSGKRDGTFLIRESSQRGCYACSVVV
DGDTKHCVIYRTATGFGFAEPYNLYGSLKELVLHYQHASLVQHNDALTVTLAHPVRAPGP
GPPPAAR
NT seq 2184 nt   +upstreamnt  +downstreamnt
atggcgggccctgagggcttccagtaccgcgctctgtacccgttccgccgggagcggccg
gaggacctggagctgctgcccggcgacgtgctggtagtgagccgggcggccttgcaggca
ctgggcgtggccgagggtggcgagcgctgcccacagagcgtgggctggatgcccggcctc
aacgagcgcacacggcagcgaggtgacttccctggcacctacgtggagttcctggggccc
gtggccctggcccggcccggccctcgcccacggggcccccgcccactgcccgccaggccc
cgtgatggggcccctgagccaggcctcacactccccgacttgcccgagcagttctcccca
cctgatgtggcgccccctcttctggtgaagcttgtggaggccattgaaaggacagggctg
gacagcgaatctcactaccggccggagctgcccgcaccgcgtacagactggtccctgagc
gacgtggatcagtgggacgcggcagccctggctgacggcattaagagcttcctgctggca
ctgcccgcgccgctcgtgacccccgaggccttggccgaggcgcgccgggccctgcgggag
gccgcggggcccgtggggccggcgctggagccaccgacgctgccgctgcaccgtgcgctc
acgctgcgcttcctgctccagcacctgggccgcgtggcccgccgcgccccggccctgggt
cccgcggtccgggccctgggcgccacctttgggccgctgctgctgcgcgcgccgccgccg
tcctcgccgccaccagggggcgctcccgacgggagtgagcccagccctgacttcccggcg
ctgctgttagagaagctgcttcaggaacacttggaagagcaggaggttgcgcccccagcg
ctgccgcctaaaccccccaaggcaaagccggcccccacaggcctggccaatggagggagc
ccaccctccctgcaggatgctgagtggtactggggggacatttcaagggaggaggtgaac
gagaaactccgggacactcccgatggcaccttcctagtccgagatgcttctagcaagatc
cagggcgagtacacgctgaccctcaggaaaggcgggaacaataagctgatcaaggtcttc
caccgagatgggcactatggcttctcagagccactcaccttctgctccgtcgtggacctc
atcaatcactaccgccacgagtcgctggcccagtacaacgccaagctggacacacggctc
ctctaccctgtgtccaaataccagcaggaccagattgtcaaggaggatagcgtggaggcg
gtgggtgcccagctcaaggtctatcaccagcaataccaggacaagagccgcgagtatgac
cagctctatgaagagtacacaaggacctcccaggagctgcagatgaagcgtaccgcaatt
gaggccttcaatgagactatcaagatctttgaagagcagggccagactcaagagaagtgc
agcaaggaatacctggagcgcttccggcgtgagggcaatgagaaagagatgcagaggatc
ctgctgaactccgagcggctcaagtcccgcattgccgagatccatgagagccgcacgaag
ctggagcagcagctgcgggcccaggcctcggacaaccgggagatcgacaagcgaatgaac
agcctcaagccggacctcatgcagctgcgcaagatccgagaccagtacctcgtgtggctc
acccagaaaggcgcccggcagaagaaaatcaacgagtggctggggattaaaaatgagact
gaggaccagtacgcgctgatggaggacgaggacgatctcccgcaccacgaggaacgcact
tggtacgtgggcaagatcaatcgcacgcaggcagaggagatgctgagcggcaagcgagat
ggcaccttcctcatccgcgagagcagccagcggggctgctacgcctgctccgtagtagtg
gacggcgacaccaagcactgcgtcatctaccgcacggccaccggcttcggcttcgcggag
ccctacaacctgtacgggtcgctgaaggagctggtgctgcactaccagcacgcctcgctc
gtgcagcacaacgacgcgctcaccgtcaccctggcgcacccagtgcgcgcccccggcccc
gggccgccgcctgccgcccgctga

KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100605788
Entry
100605788         CDS       T03265                                 

Gene name
PIK3R1
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit alpha isoform X1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle01521  EGFR tyrosine kinase inhibitor resistance
nle01522  Endocrine resistance
nle01524  Platinum drug resistance
nle04012  ErbB signaling pathway
nle04014  Ras signaling pathway
nle04015  Rap1 signaling pathway
nle04024  cAMP signaling pathway
nle04062  Chemokine signaling pathway
nle04066  HIF-1 signaling pathway
nle04068  FoxO signaling pathway
nle04070  Phosphatidylinositol signaling system
nle04071  Sphingolipid signaling pathway
nle04072  Phospholipase D signaling pathway
nle04140  Autophagy - animal
nle04150  mTOR signaling pathway
nle04151  PI3K-Akt signaling pathway
nle04152  AMPK signaling pathway
nle04210  Apoptosis
nle04211  Longevity regulating pathway
nle04213  Longevity regulating pathway - multiple species
nle04218  Cellular senescence
nle04360  Axon guidance
nle04370  VEGF signaling pathway
nle04380  Osteoclast differentiation
nle04510  Focal adhesion
nle04550  Signaling pathways regulating pluripotency of stem cells
nle04611  Platelet activation
nle04613  Neutrophil extracellular trap formation
nle04620  Toll-like receptor signaling pathway
nle04625  C-type lectin receptor signaling pathway
nle04630  JAK-STAT signaling pathway
nle04650  Natural killer cell mediated cytotoxicity
nle04660  T cell receptor signaling pathway
nle04662  B cell receptor signaling pathway
nle04664  Fc epsilon RI signaling pathway
nle04666  Fc gamma R-mediated phagocytosis
nle04668  TNF signaling pathway
nle04670  Leukocyte transendothelial migration
nle04722  Neurotrophin signaling pathway
nle04725  Cholinergic synapse
nle04750  Inflammatory mediator regulation of TRP channels
nle04810  Regulation of actin cytoskeleton
nle04910  Insulin signaling pathway
nle04914  Progesterone-mediated oocyte maturation
nle04915  Estrogen signaling pathway
nle04917  Prolactin signaling pathway
nle04919  Thyroid hormone signaling pathway
nle04923  Regulation of lipolysis in adipocytes
nle04926  Relaxin signaling pathway
nle04929  GnRH secretion
nle04930  Type II diabetes mellitus
nle04931  Insulin resistance
nle04932  Non-alcoholic fatty liver disease
nle04933  AGE-RAGE signaling pathway in diabetic complications
nle04935  Growth hormone synthesis, secretion and action
nle04960  Aldosterone-regulated sodium reabsorption
nle04973  Carbohydrate digestion and absorption
nle05010  Alzheimer disease
nle05017  Spinocerebellar ataxia
nle05020  Prion disease
nle05100  Bacterial invasion of epithelial cells
nle05135  Yersinia infection
nle05142  Chagas disease
nle05146  Amoebiasis
nle05160  Hepatitis C
nle05161  Hepatitis B
nle05162  Measles
nle05163  Human cytomegalovirus infection
nle05164  Influenza A
nle05165  Human papillomavirus infection
nle05166  Human T-cell leukemia virus 1 infection
nle05167  Kaposi sarcoma-associated herpesvirus infection
nle05168  Herpes simplex virus 1 infection
nle05169  Epstein-Barr virus infection
nle05170  Human immunodeficiency virus 1 infection
nle05171  Coronavirus disease - COVID-19
nle05200  Pathways in cancer
nle05203  Viral carcinogenesis
nle05205  Proteoglycans in cancer
nle05206  MicroRNAs in cancer
nle05210  Colorectal cancer
nle05211  Renal cell carcinoma
nle05212  Pancreatic cancer
nle05213  Endometrial cancer
nle05214  Glioma
nle05215  Prostate cancer
nle05218  Melanoma
nle05220  Chronic myeloid leukemia
nle05221  Acute myeloid leukemia
nle05222  Small cell lung cancer
nle05223  Non-small cell lung cancer
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
nle05230  Central carbon metabolism in cancer
nle05231  Choline metabolism in cancer
nle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
nle05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100605788 (PIK3R1)
   04014 Ras signaling pathway
    100605788 (PIK3R1)
   04015 Rap1 signaling pathway
    100605788 (PIK3R1)
   04370 VEGF signaling pathway
    100605788 (PIK3R1)
   04630 JAK-STAT signaling pathway
    100605788 (PIK3R1)
   04668 TNF signaling pathway
    100605788 (PIK3R1)
   04066 HIF-1 signaling pathway
    100605788 (PIK3R1)
   04068 FoxO signaling pathway
    100605788 (PIK3R1)
   04070 Phosphatidylinositol signaling system
    100605788 (PIK3R1)
   04072 Phospholipase D signaling pathway
    100605788 (PIK3R1)
   04071 Sphingolipid signaling pathway
    100605788 (PIK3R1)
   04024 cAMP signaling pathway
    100605788 (PIK3R1)
   04151 PI3K-Akt signaling pathway
    100605788 (PIK3R1)
   04152 AMPK signaling pathway
    100605788 (PIK3R1)
   04150 mTOR signaling pathway
    100605788 (PIK3R1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100605788 (PIK3R1)
  09143 Cell growth and death
   04210 Apoptosis
    100605788 (PIK3R1)
   04218 Cellular senescence
    100605788 (PIK3R1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100605788 (PIK3R1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100605788 (PIK3R1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100605788 (PIK3R1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100605788 (PIK3R1)
   04613 Neutrophil extracellular trap formation
    100605788 (PIK3R1)
   04620 Toll-like receptor signaling pathway
    100605788 (PIK3R1)
   04625 C-type lectin receptor signaling pathway
    100605788 (PIK3R1)
   04650 Natural killer cell mediated cytotoxicity
    100605788 (PIK3R1)
   04660 T cell receptor signaling pathway
    100605788 (PIK3R1)
   04662 B cell receptor signaling pathway
    100605788 (PIK3R1)
   04664 Fc epsilon RI signaling pathway
    100605788 (PIK3R1)
   04666 Fc gamma R-mediated phagocytosis
    100605788 (PIK3R1)
   04670 Leukocyte transendothelial migration
    100605788 (PIK3R1)
   04062 Chemokine signaling pathway
    100605788 (PIK3R1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100605788 (PIK3R1)
   04923 Regulation of lipolysis in adipocytes
    100605788 (PIK3R1)
   04929 GnRH secretion
    100605788 (PIK3R1)
   04915 Estrogen signaling pathway
    100605788 (PIK3R1)
   04914 Progesterone-mediated oocyte maturation
    100605788 (PIK3R1)
   04917 Prolactin signaling pathway
    100605788 (PIK3R1)
   04926 Relaxin signaling pathway
    100605788 (PIK3R1)
   04935 Growth hormone synthesis, secretion and action
    100605788 (PIK3R1)
   04919 Thyroid hormone signaling pathway
    100605788 (PIK3R1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100605788 (PIK3R1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100605788 (PIK3R1)
  09156 Nervous system
   04725 Cholinergic synapse
    100605788 (PIK3R1)
   04722 Neurotrophin signaling pathway
    100605788 (PIK3R1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100605788 (PIK3R1)
  09158 Development and regeneration
   04360 Axon guidance
    100605788 (PIK3R1)
   04380 Osteoclast differentiation
    100605788 (PIK3R1)
  09149 Aging
   04211 Longevity regulating pathway
    100605788 (PIK3R1)
   04213 Longevity regulating pathway - multiple species
    100605788 (PIK3R1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100605788 (PIK3R1)
   05206 MicroRNAs in cancer
    100605788 (PIK3R1)
   05205 Proteoglycans in cancer
    100605788 (PIK3R1)
   05203 Viral carcinogenesis
    100605788 (PIK3R1)
   05230 Central carbon metabolism in cancer
    100605788 (PIK3R1)
   05231 Choline metabolism in cancer
    100605788 (PIK3R1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100605788 (PIK3R1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100605788 (PIK3R1)
   05212 Pancreatic cancer
    100605788 (PIK3R1)
   05225 Hepatocellular carcinoma
    100605788 (PIK3R1)
   05226 Gastric cancer
    100605788 (PIK3R1)
   05214 Glioma
    100605788 (PIK3R1)
   05221 Acute myeloid leukemia
    100605788 (PIK3R1)
   05220 Chronic myeloid leukemia
    100605788 (PIK3R1)
   05218 Melanoma
    100605788 (PIK3R1)
   05211 Renal cell carcinoma
    100605788 (PIK3R1)
   05215 Prostate cancer
    100605788 (PIK3R1)
   05213 Endometrial cancer
    100605788 (PIK3R1)
   05224 Breast cancer
    100605788 (PIK3R1)
   05222 Small cell lung cancer
    100605788 (PIK3R1)
   05223 Non-small cell lung cancer
    100605788 (PIK3R1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100605788 (PIK3R1)
   05017 Spinocerebellar ataxia
    100605788 (PIK3R1)
   05020 Prion disease
    100605788 (PIK3R1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100605788 (PIK3R1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100605788 (PIK3R1)
   04932 Non-alcoholic fatty liver disease
    100605788 (PIK3R1)
   04931 Insulin resistance
    100605788 (PIK3R1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100605788 (PIK3R1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100605788 (PIK3R1)
   05100 Bacterial invasion of epithelial cells
    100605788 (PIK3R1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100605788 (PIK3R1)
   05170 Human immunodeficiency virus 1 infection
    100605788 (PIK3R1)
   05161 Hepatitis B
    100605788 (PIK3R1)
   05160 Hepatitis C
    100605788 (PIK3R1)
   05171 Coronavirus disease - COVID-19
    100605788 (PIK3R1)
   05164 Influenza A
    100605788 (PIK3R1)
   05162 Measles
    100605788 (PIK3R1)
   05168 Herpes simplex virus 1 infection
    100605788 (PIK3R1)
   05163 Human cytomegalovirus infection
    100605788 (PIK3R1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100605788 (PIK3R1)
   05169 Epstein-Barr virus infection
    100605788 (PIK3R1)
   05165 Human papillomavirus infection
    100605788 (PIK3R1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100605788 (PIK3R1)
   05142 Chagas disease
    100605788 (PIK3R1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100605788 (PIK3R1)
   01524 Platinum drug resistance
    100605788 (PIK3R1)
   01522 Endocrine resistance
    100605788 (PIK3R1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nle04131]
    100605788 (PIK3R1)
Membrane trafficking [BR:nle04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100605788 (PIK3R1)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_9 SH3_2 Laminin_I Nucleopor_Nup85 Lant_dehydr_C PI_PP_I FANCI_S2 Mod_r Bap31_Bap29_C
Other DBs
NCBI-GeneID: 100605788
NCBI-ProteinID: XP_030653598
Ensembl: ENSNLEG00000003893
LinkDB
Position
18
AA seq 724 aa
MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYN
ETTGERGDFPGTYVEYIGRKKISPPTPKPRPPRPLPVAPGSSKTEADVEQQALTLPDLAE
QFAPPDVAPPLLIKLVEAIEKKGLECSTLYRTQSSSNLAELRQLLDCDAASVDLEMIDVH
VLADAFKRYLLDLPNPVIPAAVYSEMISLAQEVQSSEEYIQLLKKLIRSPSIPHQYWLTL
QYLLKHFFKLSQTSSKNLLNARVLSEIFSPMLFRFSAASSDNTENLIKVIEILISTEWNE
RQPAPALPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDA
STKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPKL
DVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMK
RTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNYDKLKSRISEIID
SRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGN
ENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACS
VVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVYA
QQRR
NT seq 2175 nt   +upstreamnt  +downstreamnt
atgagtgctgaggggtaccagtatagagcgctgtatgattacaaaaaggaaagagaagaa
gatattgatttgcacttgggtgacatattgactgtgaataaagggtccttagtagctctt
ggattcagtgatggacaggaagccaggcctgaagaaattggctggttaaatggctataat
gaaaccacaggggaaaggggggactttccgggaacttatgtagaatatattggaaggaaa
aaaatctcgcctcccacaccaaagccccggccacctcggcctcttcctgttgcaccaggt
tcttcgaaaactgaagcagatgttgaacaacaagctttgactctcccggatcttgcagag
cagtttgcccctcctgacgttgccccgcctcttcttatcaagctcgtggaagccattgaa
aagaaaggtctggaatgttcaactctatacagaacacagagctccagcaacctggcagaa
ttacgacagcttcttgattgtgatgcagcctctgtggacttggaaatgatcgatgtgcac
gttttggccgacgctttcaaacgctatctcctggacttaccaaatcctgtcattccagca
gccgtttacagtgaaatgatttctttagctcaagaagtacaaagctccgaagaatatatt
cagctattgaagaagcttattaggtcgcctagcatacctcatcagtattggcttacgctt
cagtatttgttaaaacatttcttcaagctctctcagacctccagcaaaaatctgttgaat
gcaagagtactctctgaaattttcagccctatgcttttcagattctcagcagccagctct
gataatactgaaaacctcataaaagttatagaaattttaatctcaactgaatggaatgaa
cgacagcctgcaccagcactgcctcctaagccaccaaaacccactactgtagccaacaac
ggtatgaataacaatatgtccttacaagatgctgaatggtactggggagatatctcgagg
gaagaagtgaatgaaaaacttcgagatacagcagatgggacctttttggtacgagacgcg
tctactaaaatgcatggtgattatactcttacactaaggaaagggggaaataacaaatta
atcaaaatatttcatcgagatgggaaatatggcttctctgacccattaaccttcaattct
gtggttgagttaataaaccactaccggaatgaatctctagcgcagtataatcccaaattg
gatgtgaaattactttatccagtatccaaataccaacaggatcaagttgtcaaagaagat
aatattgaagctgtagggaaaaaattacatgaatataacactcagtttcaagaaaaaagt
cgagaatatgatagattatatgaagaatatacccgtacatcccaggaaatccaaatgaaa
aggacagctattgaagcatttaatgagaccataaaaatatttgaagaacagtgccagacc
caagagcggtacagcaaagaatacatagaaaagtttaaacgtgaaggcaatgagaaagaa
atacaaaggattatgcataattatgataagctgaagtctcgaatcagtgaaattattgac
agtagaagaagattggaagaagacttgaagaagcaggcagctgagtatcgagaaattgac
aaacgtatgaacagcattaaaccagaccttatccagctgagaaagacgagagaccaatac
ttgatgtggttgactcaaaaaggtgttcggcaaaagaagttgaacgagtggttgggcaat
gaaaacactgaagaccaatattcacttgtggaagatgatgaagatttgccccatcatgat
gagaagacgtggaatgttggaagcagcaaccgaaacaaagctgaaaacctgttgcgaggg
aagcgagatggcacttttcttgtccgggagagcagtaaacagggctgctacgcctgctct
gtagtggtggacggcgaagtaaagcattgtgtcataaacaaaacagcgactggctatggc
tttgccgagccctataacttgtacagctctctgaaagaactggtgctacattaccaacac
acctccctcgtgcagcacaacgactccctcaatgtcacactagcctacccagtatatgca
cagcagaggcgatga

DBGET integrated database retrieval system