KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100583326
Entry
100583326         CDS       T03265                                 

Gene name
TP53
Definition
(RefSeq) cellular tumor antigen p53
  KO
K04451  tumor protein p53
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle01522  Endocrine resistance
nle01524  Platinum drug resistance
nle04010  MAPK signaling pathway
nle04071  Sphingolipid signaling pathway
nle04110  Cell cycle
nle04115  p53 signaling pathway
nle04137  Mitophagy - animal
nle04151  PI3K-Akt signaling pathway
nle04210  Apoptosis
nle04211  Longevity regulating pathway
nle04216  Ferroptosis
nle04218  Cellular senescence
nle04310  Wnt signaling pathway
nle04722  Neurotrophin signaling pathway
nle04919  Thyroid hormone signaling pathway
nle05012  Parkinson disease
nle05014  Amyotrophic lateral sclerosis
nle05016  Huntington disease
nle05160  Hepatitis C
nle05161  Hepatitis B
nle05162  Measles
nle05163  Human cytomegalovirus infection
nle05165  Human papillomavirus infection
nle05166  Human T-cell leukemia virus 1 infection
nle05167  Kaposi sarcoma-associated herpesvirus infection
nle05168  Herpes simplex virus 1 infection
nle05169  Epstein-Barr virus infection
nle05200  Pathways in cancer
nle05202  Transcriptional misregulation in cancer
nle05203  Viral carcinogenesis
nle05205  Proteoglycans in cancer
nle05206  MicroRNAs in cancer
nle05210  Colorectal cancer
nle05212  Pancreatic cancer
nle05213  Endometrial cancer
nle05214  Glioma
nle05215  Prostate cancer
nle05216  Thyroid cancer
nle05217  Basal cell carcinoma
nle05218  Melanoma
nle05219  Bladder cancer
nle05220  Chronic myeloid leukemia
nle05222  Small cell lung cancer
nle05223  Non-small cell lung cancer
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
nle05230  Central carbon metabolism in cancer
nle05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100583326 (TP53)
   04310 Wnt signaling pathway
    100583326 (TP53)
   04071 Sphingolipid signaling pathway
    100583326 (TP53)
   04151 PI3K-Akt signaling pathway
    100583326 (TP53)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100583326 (TP53)
  09143 Cell growth and death
   04110 Cell cycle
    100583326 (TP53)
   04210 Apoptosis
    100583326 (TP53)
   04216 Ferroptosis
    100583326 (TP53)
   04115 p53 signaling pathway
    100583326 (TP53)
   04218 Cellular senescence
    100583326 (TP53)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100583326 (TP53)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100583326 (TP53)
  09149 Aging
   04211 Longevity regulating pathway
    100583326 (TP53)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100583326 (TP53)
   05202 Transcriptional misregulation in cancer
    100583326 (TP53)
   05206 MicroRNAs in cancer
    100583326 (TP53)
   05205 Proteoglycans in cancer
    100583326 (TP53)
   05203 Viral carcinogenesis
    100583326 (TP53)
   05230 Central carbon metabolism in cancer
    100583326 (TP53)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100583326 (TP53)
   05212 Pancreatic cancer
    100583326 (TP53)
   05225 Hepatocellular carcinoma
    100583326 (TP53)
   05226 Gastric cancer
    100583326 (TP53)
   05214 Glioma
    100583326 (TP53)
   05216 Thyroid cancer
    100583326 (TP53)
   05220 Chronic myeloid leukemia
    100583326 (TP53)
   05217 Basal cell carcinoma
    100583326 (TP53)
   05218 Melanoma
    100583326 (TP53)
   05219 Bladder cancer
    100583326 (TP53)
   05215 Prostate cancer
    100583326 (TP53)
   05213 Endometrial cancer
    100583326 (TP53)
   05224 Breast cancer
    100583326 (TP53)
   05222 Small cell lung cancer
    100583326 (TP53)
   05223 Non-small cell lung cancer
    100583326 (TP53)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100583326 (TP53)
   05014 Amyotrophic lateral sclerosis
    100583326 (TP53)
   05016 Huntington disease
    100583326 (TP53)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100583326 (TP53)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100583326 (TP53)
   05161 Hepatitis B
    100583326 (TP53)
   05160 Hepatitis C
    100583326 (TP53)
   05162 Measles
    100583326 (TP53)
   05168 Herpes simplex virus 1 infection
    100583326 (TP53)
   05163 Human cytomegalovirus infection
    100583326 (TP53)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100583326 (TP53)
   05169 Epstein-Barr virus infection
    100583326 (TP53)
   05165 Human papillomavirus infection
    100583326 (TP53)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100583326 (TP53)
   01522 Endocrine resistance
    100583326 (TP53)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:nle03000]
    100583326 (TP53)
   03036 Chromosome and associated proteins [BR:nle03036]
    100583326 (TP53)
   03400 DNA repair and recombination proteins [BR:nle03400]
    100583326 (TP53)
Transcription factors [BR:nle03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    100583326 (TP53)
Chromosome and associated proteins [BR:nle03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     100583326 (TP53)
DNA repair and recombination proteins [BR:nle03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100583326 (TP53)
SSDB
Motif
Pfam: P53 P53_tetramer TAD2 P53_TAD
Other DBs
NCBI-GeneID: 100583326
NCBI-ProteinID: XP_030656345
Ensembl: ENSNLEG00000009730
LinkDB
Position
19
AA seq 393 aa
MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPEDIAQWFTEDPGP
HEAPRMSEAAPPMAPAPAAPTLAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK
SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE
RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS
SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENFHKKGEPHHELP
PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG
GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD
NT seq 1182 nt   +upstreamnt  +downstreamnt
atggaggagccgcagtcagatcctagcgtcgagccccctctgagtcaggaaacattttca
gacctatggaaactacttcctgaaaacaacgttctgtcccccttgccgtcccaagcgatg
gatgatttgatgctgtccccggaagatattgcacaatggttcactgaagacccaggtcca
catgaagctcccagaatgtcagaggctgctcctcccatggcccccgcaccagcagctcct
acactggcggcgcctgcaccagccccctcctggcccctgtcatcctctgtcccttcccag
aaaacctaccagggcagctacggtttccgtctgggcttcttgcattctggaacagccaag
tctgtgacttgcacgtactcccctgccctcaacaagatgttttgccagctggccaagacc
tgccctgtgcagctgtgggttgattccacacccccgcccggcacccgtgtccgcgccatg
gccatctacaagcaatcacagcacatgacggaggtcgtgaggcgctgcccccaccatgag
cgctgctcagatagcgatggtctggcccctcctcagcatcttatccgagtggaaggcaat
ttgcgtgtggagtatttggatgacagaaacacttttcgacatagtgtggtggtgccctat
gagccgcctgaggttggctctgactgtaccaccatccactacaactacatgtgtaacagt
tcctgcatgggcggcatgaaccggaggcccatcctcactatcatcacactggaagactcc
agtggtaatctactgggacggaacagctttgaggtgcgcgtttgtgcctgtcctgggagg
gaccggcgcacagaggaagagaatttccacaagaaaggggagcctcaccacgagctgccc
cctgggagcactaagcgagcactgcccaacaacaccagctcctctccccagccaaagaag
aaaccactggatggagaatatttcacccttcagatccgtgggcgtgagcgcttcgagatg
ttccgagagctgaatgaggctttggaactcaaggatgcccaggctgggaaggagccaggg
gggagcagggctcactccagccacctgaagtccaagaagggtcagtctacctcccgccat
aaaaaacttatgttcaagacagaagggcctgactcagactga

DBGET integrated database retrieval system