KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100588439
Entry
100588439         CDS       T03265                                 

Gene name
RELA
Definition
(RefSeq) transcription factor p65
  KO
K04735  transcription factor p65
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle01523  Antifolate resistance
nle04010  MAPK signaling pathway
nle04014  Ras signaling pathway
nle04024  cAMP signaling pathway
nle04062  Chemokine signaling pathway
nle04064  NF-kappa B signaling pathway
nle04066  HIF-1 signaling pathway
nle04071  Sphingolipid signaling pathway
nle04137  Mitophagy - animal
nle04151  PI3K-Akt signaling pathway
nle04210  Apoptosis
nle04211  Longevity regulating pathway
nle04218  Cellular senescence
nle04380  Osteoclast differentiation
nle04620  Toll-like receptor signaling pathway
nle04621  NOD-like receptor signaling pathway
nle04622  RIG-I-like receptor signaling pathway
nle04623  Cytosolic DNA-sensing pathway
nle04625  C-type lectin receptor signaling pathway
nle04657  IL-17 signaling pathway
nle04658  Th1 and Th2 cell differentiation
nle04659  Th17 cell differentiation
nle04660  T cell receptor signaling pathway
nle04662  B cell receptor signaling pathway
nle04668  TNF signaling pathway
nle04722  Neurotrophin signaling pathway
nle04917  Prolactin signaling pathway
nle04920  Adipocytokine signaling pathway
nle04926  Relaxin signaling pathway
nle04931  Insulin resistance
nle04932  Non-alcoholic fatty liver disease
nle04933  AGE-RAGE signaling pathway in diabetic complications
nle05010  Alzheimer disease
nle05022  Pathways of neurodegeneration - multiple diseases
nle05030  Cocaine addiction
nle05132  Salmonella infection
nle05133  Pertussis
nle05134  Legionellosis
nle05135  Yersinia infection
nle05140  Leishmaniasis
nle05142  Chagas disease
nle05145  Toxoplasmosis
nle05146  Amoebiasis
nle05152  Tuberculosis
nle05160  Hepatitis C
nle05161  Hepatitis B
nle05162  Measles
nle05163  Human cytomegalovirus infection
nle05164  Influenza A
nle05165  Human papillomavirus infection
nle05166  Human T-cell leukemia virus 1 infection
nle05167  Kaposi sarcoma-associated herpesvirus infection
nle05168  Herpes simplex virus 1 infection
nle05169  Epstein-Barr virus infection
nle05170  Human immunodeficiency virus 1 infection
nle05200  Pathways in cancer
nle05202  Transcriptional misregulation in cancer
nle05203  Viral carcinogenesis
nle05212  Pancreatic cancer
nle05215  Prostate cancer
nle05220  Chronic myeloid leukemia
nle05221  Acute myeloid leukemia
nle05222  Small cell lung cancer
nle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
nle05321  Inflammatory bowel disease
nle05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100588439 (RELA)
   04014 Ras signaling pathway
    100588439 (RELA)
   04064 NF-kappa B signaling pathway
    100588439 (RELA)
   04668 TNF signaling pathway
    100588439 (RELA)
   04066 HIF-1 signaling pathway
    100588439 (RELA)
   04071 Sphingolipid signaling pathway
    100588439 (RELA)
   04024 cAMP signaling pathway
    100588439 (RELA)
   04151 PI3K-Akt signaling pathway
    100588439 (RELA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100588439 (RELA)
  09143 Cell growth and death
   04210 Apoptosis
    100588439 (RELA)
   04218 Cellular senescence
    100588439 (RELA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100588439 (RELA)
   04621 NOD-like receptor signaling pathway
    100588439 (RELA)
   04622 RIG-I-like receptor signaling pathway
    100588439 (RELA)
   04623 Cytosolic DNA-sensing pathway
    100588439 (RELA)
   04625 C-type lectin receptor signaling pathway
    100588439 (RELA)
   04660 T cell receptor signaling pathway
    100588439 (RELA)
   04658 Th1 and Th2 cell differentiation
    100588439 (RELA)
   04659 Th17 cell differentiation
    100588439 (RELA)
   04657 IL-17 signaling pathway
    100588439 (RELA)
   04662 B cell receptor signaling pathway
    100588439 (RELA)
   04062 Chemokine signaling pathway
    100588439 (RELA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100588439 (RELA)
   04917 Prolactin signaling pathway
    100588439 (RELA)
   04926 Relaxin signaling pathway
    100588439 (RELA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100588439 (RELA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100588439 (RELA)
  09149 Aging
   04211 Longevity regulating pathway
    100588439 (RELA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100588439 (RELA)
   05202 Transcriptional misregulation in cancer
    100588439 (RELA)
   05203 Viral carcinogenesis
    100588439 (RELA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100588439 (RELA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100588439 (RELA)
   05221 Acute myeloid leukemia
    100588439 (RELA)
   05220 Chronic myeloid leukemia
    100588439 (RELA)
   05215 Prostate cancer
    100588439 (RELA)
   05222 Small cell lung cancer
    100588439 (RELA)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100588439 (RELA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100588439 (RELA)
  09165 Substance dependence
   05030 Cocaine addiction
    100588439 (RELA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100588439 (RELA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100588439 (RELA)
   04931 Insulin resistance
    100588439 (RELA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100588439 (RELA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100588439 (RELA)
   05135 Yersinia infection
    100588439 (RELA)
   05133 Pertussis
    100588439 (RELA)
   05134 Legionellosis
    100588439 (RELA)
   05152 Tuberculosis
    100588439 (RELA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100588439 (RELA)
   05170 Human immunodeficiency virus 1 infection
    100588439 (RELA)
   05162 Measles
    100588439 (RELA)
   05164 Influenza A
    100588439 (RELA)
   05161 Hepatitis B
    100588439 (RELA)
   05160 Hepatitis C
    100588439 (RELA)
   05168 Herpes simplex virus 1 infection
    100588439 (RELA)
   05163 Human cytomegalovirus infection
    100588439 (RELA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100588439 (RELA)
   05169 Epstein-Barr virus infection
    100588439 (RELA)
   05165 Human papillomavirus infection
    100588439 (RELA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100588439 (RELA)
   05145 Toxoplasmosis
    100588439 (RELA)
   05140 Leishmaniasis
    100588439 (RELA)
   05142 Chagas disease
    100588439 (RELA)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100588439 (RELA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:nle03000]
    100588439 (RELA)
Transcription factors [BR:nle03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    100588439 (RELA)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 100588439
NCBI-ProteinID: XP_003274247
Ensembl: ENSNLEG00000028853
UniProt: A0A2I3GZ54
LinkDB
Position
4
AA seq 551 aa
MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC
VKKRDLEQAINQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLS
HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS
QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINY
DEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSSLAQAPAPVPVLAPGPPQA
VAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQ
GIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADM
DFSALLSQISS
NT seq 1656 nt   +upstreamnt  +downstreamnt
atggacgaactgttccccctcatcttcccggcagagccagcccaggcctctggcccctat
gtggagatcattgagcagcccaagcagcggggcatgcgcttccgctacaagtgcgagggg
cgctctgcgggcagcatcccaggcgagaggagcacagataccaccaagacccaccccacc
atcaagatcaatggctacacaggaccagggacagtacgcatctccctggtcaccaaggac
cctcctcaccggcctcacccccacgagcttgtaggaaaggactgccgggatggcttctat
gaggctgagctctgcccggaccgctgcatccacagtttccagaacctgggaatccagtgt
gtgaagaagcgggacctggagcaggctatcaatcagcgcatccagaccaacaacaacccc
ttccaagttcctatagaagagcagcgtggggactacgacctgaatgctgtgcggctctgc
ttccaggtgacagtgcgggatccatcaggcaggcccctccgcctgccgcctgtcctttct
catcccatctttgacaatcgtgcccccaacactgccgagctcaagatctgccgagtgaac
cgaaactctggcagctgccttggtggggatgagatcttcctactgtgtgacaaggtgcag
aaagaggacattgaggtgtatttcacgggaccaggctgggaggcccgaggctccttttcg
caagctgatgtgcaccgacaagtggccatagtgttccggacccctccctacgcagacccc
agcctgcaggctcctgtgcgtgtctccatgcagctgcggcggccttccgaccgggagctc
agtgagcccatggaattccagtacctgccagatacagacgatcgtcaccggattgaggag
aaacgcaaaaggacatatgagaccttcaagagcatcatgaagaagagtcctttcagcgga
cccaccgacccccggcctccacctcggcgcattgctgtgccttcccgcagctcagcttct
gtccccaagccagcaccccagccctatccctttacgtcatccctgagcaccatcaactat
gatgagtttcccacgatggtgtttccttctgggcagataagccaggcctcagccttggcc
ccggcccctccccaagtcctgccccaggctccagcccctgcccctgctccagccatggta
tcatctctggcccaggccccagcccctgtcccagtcctagccccaggccctcctcaggct
gtggccccacctgcccccaagcccacccaggctggggaaggaacgctgtcagaggccctg
ctgcagctgcagtttgatgatgaagacctgggggccttgcttggcaacagcacagaccca
gccgtgttcacagacctggcatccgtcgacaactccgagtttcagcagctgctgaaccag
ggcatacccgtggccccccacacaactgagcccatgctgatggagtaccctgaggctata
actcgcctagtgacaggggcccagaggccccccgacccagctcctgctccactgggggcc
ccggggctccccaacggcctcctttcaggagatgaagacttctcctccattgcggacatg
gacttctcagccctgctgagtcagatcagctcctaa

DBGET integrated database retrieval system