KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100588963
Entry
100588963         CDS       T03265                                 

Gene name
EGF
Definition
(RefSeq) pro-epidermal growth factor isoform X1
  KO
K04357  epidermal growth factor
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle01521  EGFR tyrosine kinase inhibitor resistance
nle04010  MAPK signaling pathway
nle04012  ErbB signaling pathway
nle04014  Ras signaling pathway
nle04015  Rap1 signaling pathway
nle04020  Calcium signaling pathway
nle04066  HIF-1 signaling pathway
nle04068  FoxO signaling pathway
nle04072  Phospholipase D signaling pathway
nle04151  PI3K-Akt signaling pathway
nle04510  Focal adhesion
nle04540  Gap junction
nle04630  JAK-STAT signaling pathway
nle04810  Regulation of actin cytoskeleton
nle05160  Hepatitis C
nle05165  Human papillomavirus infection
nle05200  Pathways in cancer
nle05210  Colorectal cancer
nle05212  Pancreatic cancer
nle05213  Endometrial cancer
nle05214  Glioma
nle05215  Prostate cancer
nle05218  Melanoma
nle05219  Bladder cancer
nle05223  Non-small cell lung cancer
nle05224  Breast cancer
nle05226  Gastric cancer
nle05231  Choline metabolism in cancer
nle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100588963 (EGF)
   04012 ErbB signaling pathway
    100588963 (EGF)
   04014 Ras signaling pathway
    100588963 (EGF)
   04015 Rap1 signaling pathway
    100588963 (EGF)
   04630 JAK-STAT signaling pathway
    100588963 (EGF)
   04066 HIF-1 signaling pathway
    100588963 (EGF)
   04068 FoxO signaling pathway
    100588963 (EGF)
   04020 Calcium signaling pathway
    100588963 (EGF)
   04072 Phospholipase D signaling pathway
    100588963 (EGF)
   04151 PI3K-Akt signaling pathway
    100588963 (EGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100588963 (EGF)
   04540 Gap junction
    100588963 (EGF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100588963 (EGF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100588963 (EGF)
   05231 Choline metabolism in cancer
    100588963 (EGF)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100588963 (EGF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100588963 (EGF)
   05212 Pancreatic cancer
    100588963 (EGF)
   05226 Gastric cancer
    100588963 (EGF)
   05214 Glioma
    100588963 (EGF)
   05218 Melanoma
    100588963 (EGF)
   05219 Bladder cancer
    100588963 (EGF)
   05215 Prostate cancer
    100588963 (EGF)
   05213 Endometrial cancer
    100588963 (EGF)
   05224 Breast cancer
    100588963 (EGF)
   05223 Non-small cell lung cancer
    100588963 (EGF)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100588963 (EGF)
   05165 Human papillomavirus infection
    100588963 (EGF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100588963 (EGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:nle04052]
    100588963 (EGF)
Cytokines and growth factors [BR:nle04052]
 Growth factors
  Growth factors (RTK binding)
   100588963 (EGF)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition EGF cEGF EGF_CA DUF5050 EGF_3
Other DBs
NCBI-GeneID: 100588963
NCBI-ProteinID: XP_003269399
Ensembl: ENSNLEG00000016536
UniProt: G1S3J7
LinkDB
Position
18
AA seq 1208 aa
MLLILFILLPVVLKFSFVSLSAPQHWRCPEGTLAGNENSTCVGPAPFLIFSHGNSIFRID
TEGTNYEQLVVDAGVSVIMDFHYNEKIIYWVDLERQLLQRVFLNGSRQERVCNIEKNVSG
MAINWINEEVIWSNQQEGIITVTDMKGNNSHVLLRALKYPANIAVDPVERFIFWSSEVAG
SLYRADLDGVEVKALLETSEKITAVSLDVLDKRLFWIQYNREGSNSLICSCDYDGGSVHI
SKHPTQHNVFAMSVFGDRIFYLTWKTKTIWIANKHTGKDMVRINLHSSFVPPGELKVVHP
LAQPKAEDDAREPEQKLRKLRKGNCSSTVCGQDPQSHLCTCAEGYALSRDRKYCEDVNEC
AFWNHGCTLGCKNTPGSYYCTCPVGFVLLPDGKRCHQLVSCPSNVSECSHDCVLTSEGPL
CFCPEGSVLERDGKTCSGCSSPDNGGCSQLCIPLSPVSWECDCFPGYDLQLDKKSCAASG
PQPFLLFANSQDIRHMHFDGTDYGTLLSQQMGMVYALDHDPVENKIYFAHTALKWIERAN
MDGSQRERLIEEGVDVPEGLAVDWIGRRVYWTDRGKSLIGRSDLNGKRSKIITKENISQP
RGIAVHPMAKRLFWTDTGINPRIESSSLQGLGRLVIASSDLIWPSGITIDFLTDKLYWCD
AKQSVIEMANLDGSKRQRLTQNDVGHPFAVAVFEDYVWFSDWAMPSVMRVNKRTGKDRVR
LQGSMLKPSSLVVVHPLAKPGADPCLYQNGGCEHICKERLGTAWCSCREGFMKASDGKTC
LALDGHQLLAGGEVDLKNQVTPLDILSETRVSEDNITESQQMLVAEIMVSDQDDCAPVGC
STYARCISEGEDATCQCLKGFAGDGKLCSDIDECEMGVPVCPPASSKCINTEGGYVCQCS
EGYQGDGIHCFDIDECQLGVHSCRENANCTNTEGGYTCMCAGRLSEPGLICPDSTPPPHL
REDDHHYSIRNSDSGCPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYQDLKWW
ELRHAGHGQQRKVTVVAVCVVVLVVLLLLSLWGAHYYRTQKLLSKNPKNPYEESSRDVRS
RRPADTEDGMSSCPQPWFVVVKEHQDLRNGSQPVAGEDGQAADVGSVQPTSWRQEPQLCG
MGTGQGFWIPVSSDKGSCPQVMEQSFHMPSYGTQPLEGGVEKPHSLLSANPLWQQRALDP
PHQMELTQ
NT seq 3627 nt   +upstreamnt  +downstreamnt
atgctgctcattcttttcattctgttgccagtagttttaaaatttagttttgttagtctc
tcagcaccgcagcactggagatgtcctgaaggtactctcgcaggaaatgagaattctact
tgtgtgggtcctgcacccttcttaattttctcccacggaaatagtatctttaggattgac
acagaaggaaccaattatgagcaattggtggtggatgctggtgtctcagtgatcatggat
tttcattataatgagaaaataatctattgggtggatttagaaagacaacttttgcaaaga
gtttttctgaatgggtcaaggcaagagagagtatgtaatatagagaaaaatgtttctgga
atggcaataaattggataaatgaagaagttatttggtcaaatcaacaggaaggaatcatt
accgtaacagatatgaaaggaaataattcccacgttcttttacgtgctttaaaatatcct
gcaaatatagcagttgatccagtagaaaggtttatattttggtcttcagaggtggctggc
agcctttatagagcagatctcgatggtgtggaagtgaaggctctgttggagacatcagag
aaaataacagctgtgtcattggatgtgcttgataagcggctgttttggattcagtacaac
agagaaggaagcaattctcttatttgctcctgtgattatgatggaggttctgtccacatt
agtaaacatccaacacagcacaatgtgtttgcaatgtccgtttttggtgaccgtatcttc
tatttaacatggaaaacgaagacaatttggatagccaacaaacacactggaaaggatatg
gttagaattaacctccattcatcatttgtaccacctggtgaactgaaagtagtgcatcca
ctcgcacaacccaaggcagaagatgatgcccgggagcctgagcagaaacttcgcaaattg
aggaaaggaaactgcagcagcactgtgtgtgggcaagacccccagtcacacttgtgcacg
tgtgcagagggatatgccctaagtcgagaccggaagtactgtgaagatgttaatgaatgt
gctttttggaatcatggctgtactcttgggtgtaaaaacacccctggatcctattactgc
acatgccctgtaggatttgttctgcttcctgatgggaaacgatgtcatcaacttgtttcc
tgtccaagcaatgtgtctgaatgcagccatgactgtgttctgacatcagaaggtccctta
tgtttctgtcctgaaggctcggtgcttgagagagatgggaaaacatgtagcggttgttcc
tcacctgataatggtggatgtagccagctctgcattcctctcagcccagtatcctgggaa
tgtgattgctttcctgggtatgacctacaactggataaaaaaagctgtgcagcttcagga
ccacaaccatttttgctgtttgccaattctcaagatattcgacacatgcattttgatgga
acagactatggaactctgctcagccagcagatgggaatggtttatgccctagatcatgac
cctgtggaaaataagatatactttgcccatacagccctgaagtggatagagagagctaat
atggatggttcccagcgagaaaggcttattgaggaaggagtagatgtgccagaaggtctt
gctgtggactggattggccgtagagtctattggacagacagagggaaatctctgattgga
aggagtgatttaaatggaaaacgttccaaaataatcactaaggagaacatctctcaacca
cgaggaattgctgttcatccaatggccaagagattattctggactgatacagggattaat
ccacgaattgaaagttcttccctccaaggccttggccgactggttatagccagctctgat
ctaatctggcccagtggaataacgattgacttcttaactgacaagttgtattggtgtgat
gccaagcagtctgtgattgaaatggccaatctggatggttcaaaacgccaaagacttacc
cagaatgatgtaggtcacccatttgctgtagccgtgtttgaggattatgtgtggttctca
gattgggctatgccgtcagtaatgagagtaaacaagaggactggcaaagatagagtacgt
ctccaaggcagcatgctgaagccctcatcactggttgtggttcatccattggcaaaacca
ggagcagatccctgcttatatcaaaacggaggctgtgaacatatttgcaaagagaggctt
ggaactgcttggtgttcgtgtcgtgaaggttttatgaaagcctcagatgggaaaacgtgt
ctggctctggatggtcatcagctgttggcaggtggtgaagttgatctaaagaaccaagta
acaccattggacatcttgtccgagactagagtgtcagaagataacattacagaatctcaa
caaatgctagtggctgaaatcatggtgtcagatcaagatgactgtgctcctgtgggatgc
agcacgtatgctcggtgtatttcagagggagaggatgccacatgtcagtgtttgaaagga
tttgctggggatggaaaactatgttctgatatagatgaatgtgagatgggtgtcccagtg
tgcccccctgcctcctccaagtgcatcaacaccgaaggtggctatgtctgccagtgctca
gaaggctaccaaggagatgggattcactgttttgatattgatgagtgccagctgggggtg
cacagctgtagagagaatgccaattgcacaaatacagagggaggctatacctgcatgtgt
gctggacgcctgtctgaaccaggactgatttgccctgactctactccaccccctcacctc
agggaagatgaccaccactattccataagaaatagtgactctggatgtcccctgtcccac
gatgggtactgtctccatgatggtgtgtgcatgtatattgaagcactggacaagtatgca
tgcaactgtgttgttggctacatcggggagcgatgtcagtaccaagacctgaagtggtgg
gaactgcgccacgctggccacgggcagcagcggaaggtcaccgtggtggctgtctgcgtg
gtggtgcttgtcgtgctgctcctcctgagcctgtggggggcccactactacaggactcag
aagctgctatcaaaaaatccaaagaatccttatgaggagtcaagcagagatgtgaggagt
cgcaggcctgctgacactgaggatgggatgtcctcttgccctcaaccttggtttgtggtt
gtaaaggaacaccaagacctcaggaatgggagtcaaccagtggctggtgaggatggccag
gcagcagatgttgggtcagtgcaaccaacttcatggaggcaggagccccagttatgtgga
atgggcacagggcaaggcttctggattccagtatccagtgataagggctcctgtccccag
gtaatggagcaaagctttcatatgccctcctatgggacacagccccttgaagggggtgtt
gagaagccccattctctcctatcagctaacccattatggcaacaaagggccctggaccca
ccacaccaaatggagctgactcagtga

DBGET integrated database retrieval system